ПАТЕНТНЫЙ ПОИСК В РФ
НОВЫЕ ПАТЕНТЫ, ЗАЯВКИ НА ПАТЕНТ
БИБЛИОТЕКА ПАТЕНТОВ НА ИЗОБРЕТЕНИЯ

хиназолиноны как ингибиторы пролилгидроксилазы

Классы МПК:C07D403/04 связанные непосредственно
C07D401/14 содержащие три или более гетероциклических кольца
C07D405/14 содержащие три или более гетероциклических кольца
C07D487/04 орто-конденсированные системы
C07D491/056 с двумя или более атомами кислорода в качестве гетероатомов в кислородсодержащем кольце
A61K31/517  орто- или пери- конденсированные с карбоциклическими системами, например хиназолин, перимидин
A61K31/519  орто- или пери-конденсированные с гетероциклическими кольцами
A61P9/10 для лечения ишемических или атеросклеротических заболеваний, например антиангинозные средства, коронарные вазодилататоры, средства для лечения инфаркта миокарда, ретинопатии, цереброваскулярной недостаточности почечного артериосклероза
A61P3/10 для лечения гипергликемии, например антидиабетические средства
A61P3/06 средства против повышенного содержания жира в крови (гиперлипемии)
A61P43/00 Лекарственные средства для специфических целей, не указанные в группах  1/00
Автор(ы):, , , , , ,
Патентообладатель(и):ЯНССЕН ФАРМАЦЕВТИКА НВ (BE)
Приоритеты:
подача заявки:
2010-02-10
публикация патента:

Изобретение относится к хиназолиноновым соединениям формулы (I) и его фармацевтически приемлемым солям, в которой n равно от 0 до 3 и R1 имеет определения, указанные в формуле изобретения. Данные соединения являются ингибиторами пролилгидроксилазы и могут быть использованы в фармацевтических композициях и способах лечения патологических состояний, расстройств и состояний, опосредуемых активностью пролилгидроксилазы. Так, данные соединения могут вводиться пациенту для лечения, например, анемии, заболеваний сосудов, нарушений обмена веществ, а также для заживления ран. 9 н. и 13 з.п. ф-лы, 2 табл., 211 пр.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Рисунки к патенту РФ 2528412

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Перекрестные ссылки на смежные изобретения

Настоящая заявка истребует приоритет по предварительной заявке на патент США за номером 61/151429, поданной 10 февраля 2009 года.

Область изобретения

Настоящее изобретение относится к некоторым производным хиназолинона, содержащим их фармацевтическим композициям и способам их использования для лечения патологических состояний, расстройств и состояний, опосредуемых активностью пролилгидроксилазы.

Предпосылки создания изобретения

Клетки реагируют на гипоксию активацией транскрипции генов, участвующих в выживании клетки, доставке и использовании кислорода, ангиогенезе, клеточном метаболизме, регулировании кровяного давления, гематопоэзе и сохранении ткани. Индуцированные гипоксией факторы (HIF) являются ключевыми транскрипционными регуляторами этих генов (Semenza et al., 1992, Mol Cell Biol., 12(12):5447-54; Wang et al., 1993, J Biol Chem., 268(29):21513-18; Wang et al., 1993, Proc Natl Acad Sci., 90:4304-08; Wang et al., 1995, J Biol Chem., 270(3):1230-37). Описаны три типа факторов HIF-a: HIF-1b, HIF-2a и HIF-3a (Scheuermann et al., 2007, Methods Enzymol., 435:3-24). Конъюгация субъединицы HIFa с HIF-1b образует функциональный гетеродимерный белок, который, в свою очередь, вовлекает другие транскрипционные факторы, такие как p300 и CBP (Semenza, 2001, Trends Mol Med., 7(8):345-50).

Семейство высококонсервативных кислород-, железо- и 2-оксоглутарат-зависимых энзимов пролилгидроксилазы (PHD) являются промежуточным звеном реакции клеток на гипоксию посредством посттрансляционной модификации HIF (Ivan et al., 2001, Science, 292:464-68; Jaakkola et al., 2001, Science, 292:468-72). В условиях нормального снабжения кислородом PHD катализирует гидроксилирование двух консервативных групп пролина в HIF. Белок фон Гиппеля-Линдау (VHL) избирательно связывается с гидроксилированным HIF. Связывание с VHL делает HIF мишенью для полиубиквитинилирования комплексом убиквитин-лигазы Е3 и его последующей деградации 26S-протеасомой (Ke et al., 2006, Mol Pharmacol. 70(5):1469-80; Semenza, Sci STKE., 2007, 407(cm8):1-3). Так как сродство PHD к кислороду находится в физиологическом диапазоне кислорода, а кислород является необходимым кофактором реакции, PHD инактивируется при снижении концентрации кислорода. Таким образом, HIF быстро распадается при нормальных условиях снабжения кислородом, но накапливается в клетках в условиях гипоксии или при ингибировании PHD.

Описаны четыре изотипа PHD: PHD1, PHD2, PHD3 и PHD4 (Epstein et al., 2001, Cell, 107:43-54; Kaelin, 2005, Annu Rev Biochem., 74:115-28; Schmid et al., 2004, J Cell Mol Med., 8:423-31). Различные изотипы экспрессируются повсюду, но регулируются различным образом и играют различные физиологические роли в клеточном ответе на гипоксию. Имеются данные, что различные изотипы обладают разной селективностью по отношению к трем разным подтипам HIFa (Epstein et al., см. выше). С точки зрения внутриклеточной локализации, PHD1 находится, главным образом, в ядре, PHD2 - в цитоплазме, а PHD3 распространен как в ядре, так и в цитоплазме (Metzen E, et al., 2003, J Cell Sci., 116(7):1319-26). PHD2 является преобладающей HIFхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пролилгидроксилазой при гипоксических условиях (Ivan et al., 2002. Proc Natl Acad Sci. USA, 99(21):13459-64; Berra et al., 2003, EMBO J., 22:4082-90). Все три изотипа имеют высокую степень аминокислотной гомологии, а активный центр фермента является высококонсервативным.

Продукты целевого для HIF гена участвуют в ряде физиологических и патофизиологических процессов, включая, помимо прочего, следующие: эритро(цито)поэз, развитие кровеносных сосудов, регулирование энергетического обмена, вазомоторную функцию и апоптоз/пролиферацию клеток. Первым геном, описанным в качестве целевого для HIF, был ген, кодирующий эритропоэтин (ЭПО) (Wang et al., 1993, см. выше). Было показано, что снижение кислородопереносной функции крови воспринимается почками, и что почки и печень реагируют на это выработкой большего количества ЭПО - гормона, который стимулирует пролиферацию и созревание эритроцитов. ЭПО оказывает разностороннее воздействие на некроветворные типы клеток и выступает в роли основного защищающего ткани цитокина (Arcasoy, 2008, Br J Haematol., 141:14-31). Поэтому сегодня предполагается участие ЭПО в процессах заживления ран и ангиогенеза, а также в реакции тканей на ишемический инсульт. Большинство вовлеченных в анаэробный гликолиз ферментов кодированы целевыми генами HIF, в результате чего гликолиз усиливается в гипоксических тканях (Shaw, 2006, Curr Opin Cell Biol., 18(6):598-608). Известные продукты целевого для HIF гена в этом пути метаболизма включают, помимо прочего, следующие: переносчики глюкозы, такие как GLUT-1 (Ebert et al., 1995, J Biol Chem., 270(49):29083-89), ферменты, участвующие в расщеплении глюкозы до пируватов, такие как гексокиназа и фосфоглицераткиназа 1 (Firth et al., 1994, Proc Natl Acad Sci. USA91:6496-6500), а также лактатдегидрогеназа (Firth et al., см. выше). Продукты целевого гена HIF также участвуют в регулировании клеточного метаболизма. Например, киназа пируватдегидрогеназы 1 является продуктом целевого гена HIF и регулирует поступление пирувата в цикл Кребса, снижая активность пируватдегидрогеназы путем фосфорилирования (Kim et al., 2006, Cell Metab., 3:177-85; Papandreou et al., 2006, Cell Metab., 3:187-197). Продукты целевого гена HIF также участвуют в процессах ангиогенеза. Например, фактор роста эндотелия сосудов (VEGF) (Liu et al., 1995, Circ Res., 77(3):638-43) является известным регулятором процессов ангиогенеза и васкулогенеза. Продукты целевого гена HIF также участвуют в регулировании сосудистого тонуса и включают гемоксигеназу-1 (Lee et al., 1997, J Biol Chem., 272(9):5375-81). Ряд продуктов регулируемых HIF генов, такие как тромбоцитарный фактор роста (PDGF) (Yoshida et al., 2006, J Neurooncol., 76(1):13-21), сосудистый эндотелиальный фактор рост (Breen, 2007, J Cell Biochem., 102(6):1358-67) и ЭПО (Arcasoy, см. выше), также совместно участвуют в реакции при заживлении раны.

Направленное нарушение активности фермента пролилгидроксилазы (PHD) с помощью малых молекул может найти применение для лечения расстройств восприятия и распределения кислорода. Примеры последних включают, помимо прочего, следующее: анемия; менискоцитарная анемия; болезнь периферических сосудов; ишемическая болезнь сердца; сердечная недостаточность; защита тканей от ишемии в таких условиях, как ишемия миокарда, инфаркт миокарда и инсульт; консервация органов для трансплантации; лечение ишемии тканей посредством регулирования и (или) восстановления тока крови, доставки кислорода и (или) использования энергии; ускорение процесса заживления ран, в частности, у пожилых пациентов и пациентов, страдающих диабетом; лечение ожогов; лечение инфекционных заболеваний; срастание переломов и рост костей. Кроме того, предполагается, что направленное нарушение активности PHD может найти применение для лечения таких нарушений обмена веществ, как диабет, ожирение, неспецифический язвенный колит, воспалительное заболевание кишечника и родственных заболеваний, таких как болезнь Крона (Recent Patents on Inflammation & Allergy Drug Discovery, 2009, 3, 1-16).

Показано, что HIF является основным транскрипционным фактором, который приводит к повышению продуцирования эритропоэтина в условиях гипоксии (Wang et al., 1993, см. выше). Несмотря на то, что применение рекомбинантного человеческого эритропоэтина показало себя эффективным при лечении анемии, можно ожидать, что ингибирование PHD малыми молекулами будет иметь некоторые преимущества в сравнении с лечением эритропоэтином. В частности, функционирование других продуктов гена HIF необходимо для гемопоэза, а регулирование этих факторов повышает эффективность гемопоэза. Примеры продуктов, критически важных для гемопоэза целевого гена HIF, включают: трансферрин (Rolfs et al., 1997, J Biol Chem., 272(32):20055-62), трансферриновый рецептор (Lok et al., 1999, J Biol Chem., 274(34):24147-52; Tacchini et al., 1999, J Biol Chem., 274(34):24142-46) и церулоплазмин (Mukhopadhyay et al., 2000, J Biol Chem., 275(28):21048-54). Экспрессия гепсидина также подавляется HIF (Peyssonnaux et al., 2007, J Clin Invest., 117(7):1926-32), а ингибирующие PHD малые молекулы, как было показано, уменьшают выработку гепсидина (Braliou et al., 2008, J Hepatol., 48:801-10). Гепсидин является отрицательным фактором регулирования доступности железа, необходимого для гемопоэза, поэтому ожидается, что уменьшение выработки гепсидина будет благотворно сказываться на лечении анемии. Ингибирование PHD также может быть полезным в сочетании с другими терапиями анемии, включая введение железа и (или) экзогенного эритропоэтина. Исследования естественных мутаций гена PHD2 у человеческого населения дают еще одно основание для использования ингибиторов PHD при лечении анемии. В двух недавних работах было показано, что у пациентов с дисфункциональными мутациями в гене PHD2 наблюдается повышенный эритроцитоз и повышенный уровень гемоглобина в крови (Percy et al., 2007, PNAS, 103(3):654-59; Al-Sheikh et al., 2008, Blood Cells Mol Dis., 40:160-65). Кроме того, низкомолекулярный ингибитор PHD был испытан на здоровых добровольцах и на пациентах с хроническими заболеваниями почек (Заявка на патент США US2006/0276477, 07 декабря 2006 г.). У пациентов с хроническими заболеваниями почек содержание эритропоэтина в плазме увеличивалось в зависимости от дозы и повышалось содержание гемоглобина в крови.

Ишемия представляет опасность для метаболической адаптации и защиты тканей. Ингибиторы PHD повышают экспрессию генов, что приводит к изменениям в процессе обмена веществ, благотворным в условиях ишемии (Semenza, 2007, Biochem J., 405:1-9). Многие из генов, кодирующих участвующие в анаэробном гликолизе ферменты, регулируются HIF, и ингибирование PHD увеличивает гликолиз (Shaw, см. выше). Известные целевые гены HIF в этом пути метаболизма включают, помимо прочего, следующие: GLUT-1 (Ebert et al., см. выше), гексокиназу, фосфоглицераткиназу 1, лактатдегидрогеназу (Firth et al., см. выше), киназу пируватдегидрогеназы 1 (Kim et al., см. выше; Papandreou et al., см. выше). Киназа пируватдегидрогеназы 1 подавляет вхождение пируватов в цикл Кребса. HIF выступает в роли посредника в переключении экспрессии цитохромов, участвующих в процессе переноса электрона в митохондриях (Fukuda et al., 2007, Cell, 129(1):111-22). Это изменение состава цитохромов оптимизирует эффективность выработки АТФ в условиях гипоксии и снижает производство таких вредных побочных продуктов окислительного фосфорилирования, как перекись водорода и пероксид-анион. При продолжительном воздействии гипоксии HIF стимулирует аутофагию митохондрий, в результате чего их количество уменьшается (Zhang H et al., 2008, J Biol Chem. 283: 10892-10903). Эта адаптация к хронической гипоксии снижает производство перекиси водорода и пероксид-аниона, когда клетка в основном использует гликолиз для производства энергии. Еще одна адаптивная реакция, вызванная повышением экспрессии HIF, заключается в активации факторов выживаемости клеток. К этим факторам относятся следующие: инсулиноподобный фактор роста (IGF) 2, IGF-связывающие белки 2 и 3 (Feldser et al., 1999, Cancer Res.59:3915-18). Общее накопление HIF в условиях гипоксии управляет адаптивной активацией гликолиза, снижением окислительного фосфорилирования, что приводит к уменьшению производства перекиси водорода и супероксида, и оптимизацией окислительного фосфорилирования, защищая клетки от ишемического повреждения. Поэтому предполагается, что ингибиторы PHD могут найти применение для консервации органов и тканей для трансплантации (Bernhardt et al., 2007, Methods Enzymol., 435:221-45). Хотя положительный эффект может быть получен путем введения ингибиторов PHD до забора органов для трансплантации, введение ингибитора непосредственно в орган/ткань после забора, при хранении (например, кардиоплегический раствор) или после трансплантации, также может иметь терапевтический эффект.

Предполагается, что ингибиторы PHD окажутся эффективны для защиты тканей от локальной ишемии и (или) гипоксии, в том числе от ишемии/гипоксии, связанных, среди прочего, со следующим: ангина, ишемия миокарда, инсульт, ишемия скелетной мышцы. Существует целый ряд экспериментальных доказательств того, что ингибирование PHD и последующее повышение экспрессии HIF является возможным способом консервации ишемической ткани. Недавно было показано, что ишемическое прекондиционирование является HIF-зависимым явлением (Cai et al., 2008, Cardiovasc Res., 77(3):463-70). Ишемическое прекондиционирование - это известное явление, в соответствии с которым короткие периоды гипоксии и (или) ишемии защищают ткань от последующих более продолжительных периодов ишемии (Murry et al., 1986, Circulation, 1986 74(5):1124-36; Das et al., 2008, IUBMB Life, 60(4):199-203). Известно, что ишемическое прекондиционирование наблюдается у людей, а также у экспериментальных животных (Darling et al., 2007, Basic Res Cardiol., 102(3):274-8; Kojima I et al., 2007, J Am Soc Nephrol., 18:1218-26). Несмотря на то, что концепция прекондиционирования более всего известна благодаря своим защитным воздействиям на сердце, она также применима и к другим тканям, включая, помимо прочего, следующие: печень, скелетные мышцы, легкие, почки, кишечник и мозг (Pasupathy et al., 2005, Eur J Vasc Endovasc Surg., 29:106-15; Mallick et al., 2004, Dig Dis Sci., 49(9):1359-77). Экспериментальное подтверждение защитного действия на ткани ингибирования PHD и повышения HIF получено на ряде животных моделей, включая: нокаутирование зародышевой линии PHD1, что обеспечило защиту скелетной мышцы от ишемического инсульта (Aragones et al., 2008, Nat Genet., 40(2):170-80), выключение PHD2 путем применения миРНК, что обеспечило защиту сердца от ишемического инсульта (Natarajan et al., 2006, Circ Res., 98(1):133-40), ингибирование PHD путем введения моноксида углерода, что обеспечило защиту миокарда от ишемического поражения (Chin et al., 2007, Proc Natl Acad Sci. U.S.A., 104(12):5109-14), гипоксию в мозге, которая повышала переносимость ишемии (Bernaudin et al., 2002, J Cereb Blood Flow Metab., 22(4):393-403). Кроме того, низкомолекулярные ингибиторы PHD обеспечивают защиту мозга в экспериментальных моделях инсульта (Siddiq et al., 2005, J Biol Chem., 280(50):41732-43). Более того, было показано, что активация HIF защищает сердце мышей, страдающих диабетом, где результаты обычно хуже (Natarajan et al., 2008, J Cardiovasc Pharmacol., 51(2):178-187). Эффекты защиты тканей можно также наблюдать при облитерирующем тромбангиите (болезнь Бюргера), симметричной гангрене (болезнь Рейно) и акроцианозе.

Снижение зависимости от аэробного метаболизма цикла Кребса в митохондрии и повышение роли анаэробного гликолиза, вызванное ингибированием PHD, может оказывать благоприятное влияние на ткани с нормальным снабжением кислородом. Важно отметить, что ингибирование PHD, как было показано, повышает экспрессию HIF в условиях нормального снабжения кислородом. Таким образом, ингибирование PHD вызывает псевдогипоксию, обусловленную инициированным HIF гипоксическим откликом, но при этом насыщение тканей кислородом остается нормальным. Можно также ожидать, что вызванная ингибированием PHD перестройка метаболизма позволит реализовать способ лечения диабета, ожирения и связанных с ними расстройств, включая сопутствующие заболевания.

В целом, совокупность вызванных ингибированием PHD изменений экспрессии генов снижает количество энергии, производимой на единицу глюкозы, и будет стимулировать организм на сжигание большего количества жира для поддержания энергетического баланса. Механизмы интенсификации гликолиза рассматриваются выше. Другие исследования связывают гипоксический отклик с теми эффектами, которые могут оказаться полезными при лечении диабета и ожирения. Так, хорошо известно, что тренировки в условиях высокогорья снижают количество жира в организме (Armellini et al., 1997, Horm Metab Res., 29(9):458-61). Показано, что гипоксия и имитирующие гипоксию вещества, такие как десферриоксамин, предотвращают дифференцирование в адипоциты (Lin et al., 2006, J Biol Chem., 281(41):30678-83; Carriere et al., 2004, J Biol Chem., 279(39):40462-69). Этот эффект является обратимым по возвращении к нормальным условиям снабжения кислородом. Ингибирование активности PHD на начальных стадиях липогенеза подавляет образование новых адипоцитов (Floyd et al., 2007, J Cell Biochem., 101:1545-57). Гипоксия, хлорид кобальта и десферриоксамин повышают экспрессию HIF и ингибируют транскрипцию ядерных рецепторов гормонов PPAR гамма 2 (Yun et al., 2002, Dev Cell., 2:331-41). Так как PPAR гамма 2 является важным сигналом для дифференцировки в адипоцит, то следует ожидать, что ингибирование PHD будет подавлять дифференцировку в адипоциты. Было показано, что эти эффекты опосредуются регулируемым HIF геном DEC1/Stra13 (Yun et al., см. выше).

Показано, что низкомолекулярные ингибиторы PHD оказывают лечебное воздействие в животных моделях диабета и ожирения (Междунар. заявки на патент WO2004/052284, 24 июня 2004 г.; WO2004/052285, 24 июня 2004 г.). Эффекты, показанные для ингибиторов PHD на мышах с алиментарным ожирением, мышах линии db/db и крысах линии Zucker fa/fa, включали понижение следующего: концентрации глюкозы в крови, массы жира как в абдоминальном, так и в висцеральном скоплении жировой ткани, концентрации гемоглобина A1c, триглицеридов в плазме, массы тела, а также изменения концентраций известных биомаркеров заболевания, такие как повышение уровней адреномедуллина и лептина. Лептин является известным продуктом целевого гена HIF (Grosfeld et al., 2002, J Biol Chem., 277(45):42953-57). Продукты генов, участвующие в метаболизме жировых клеток, как было показано, должны регулироваться ингибированием PHD HIF-зависимым образом (Международная заявка на патент WO2004/052285, см. выше). К таким продуктам относятся: аполипопротеин A-IV, ацил-CoA-тиоэстераза, карнитинацетил-трансфераза и связывающий инсулиноподобный фактор роста белок (IGFBP)-1.

Ожидается, что ингибиторы PHD могут оказаться терапевтически эффективными как стимуляторы васкулогенеза, ангиогенеза и артериогенеза. Эти процессы создают или восстанавливают ток крови к тканям и их насыщение кислородом в условиях ишемии и (или) гипоксии (Semenza et al., 2007, J Cell Biochem., 102:840-47; Semenza, 2007, Exp Physiol., 92(6):988-91). Было показано, что физическая нагрузка повышает экспрессию HIF-1 и сосудистого эндотелиального фактора роста в экспериментальных животных моделях и у людей (Gustafsson et al. 2001, Front Biosci., 6:D75-89) и, соответственно, количество кровеносных сосудов в скелетной мышце. VEGF (фактор роста васкулярного эндотелия) представляет собой хорошо известный продукт целевого гена HIF, являющийся ключевым фактором ангиогенеза (Liu et al., см. выше). Несмотря на то, что введение различных форм активаторов рецептора VEGF является сильнодействующим стимулом ангиогенеза, формирующиеся в результате этого потенциального способа лечения кровеносные сосуды являются неплотными. Считается, что это ограничивает возможность использования VEGF для лечения расстройств доставки кислорода. Повышение экспрессии одного ангиогенного фактора может быть недостаточным для функциональной васкуляризации (Semenza, 2007, см. выше). Потенциальные преимущества ингибирования PHD в сравнении с другими подобными способами ангиогенной терапии состоят в стимулировании контролируемой экспрессии множества ангиогенных факторов роста HIF-зависимым образом, включая, помимо прочего, следующие: плацентарный фактор роста (PLGF), ангиопоэтин-1 (ANGPT1), ангиопоэтин-2 (ANGPT2), бета-фактор роста тромбоцитарный (PDGFB) (Carmeliet, 2004, J Intern Med., 255:538-61; Kelly et al., 2003, Circ Res., 93:1074-81) и фактор роста стромальных клеток-1 (SDF-1) (Ceradini et al., 2004, Nat Med., 10(8):858-64). Экспрессия ангиопоэтина-1 в процессе ангиогенеза приводит к образованию плотных кровеносных сосудов, в отличие от кровеносных сосудов, образующихся при введении только VEGF (Thurston et al., 1999, Science, 286:2511-14; Thurston et al., 2000, Nat Med., 6(4):460-3; Elson et al., 2001, Genes Dev., 15(19):2520-32). Было показано, что фактор роста стромальных клеток 1 (SDF-1) чрезвычайно важен для активации процесса притока предшественников эндотелиальных клеток к местам повреждения ткани. Экспрессия SDF-1 повышает адгезию, миграцию и хоуминг циркулирующих CXCR4-положительных клеток-предшественников к ишемической ткани. Более того, ингибирование SDF-1 в ишемической ткани или блокада CXCR4 на клетках, циркулирующих в периферической крови, предотвращает привлечение клеток-предшественников к местам повреждения (Ceradini et al., 2004, см. выше; Ceradini et al., 2005, Trends Cardiovasc Med., 15(2):57-63). Важно, что у взрослых мышей привлечение предшественников эндотелиальных клеток к местам повреждения снижается, и это может быть компенсировано вмешательствами, которые повышают активность HIF на месте раны (Chang et al., 2007, Circulation, 116(24):2818-29). Ингибирование PHD дает преимущества не только за счет увеличения экспрессии ряда ангиогенных факторов, но также за счет координации их экспрессии в течение всего процесса ангиогенеза и привлечения предшественников эндотелиальных клеток к ишемической ткани.

Свидетельства применимости ингибиторов PHD в проангиогенной терапии представлены в следующих исследованиях. Было показано, что опосредуемая аденовирусом повышенная экспрессия HIF индуцирует ангиогенез в неишемической ткани взрослого животного (Kelly et al., 2003, Circ Res., 93(11):1074-81), свидетельствуя о том, что терапии с повышением экспрессии HIF, например ингибирование PHD, будут вызывать развитие кровеносных сосудов. Было показано, что плацентарный фактор роста (PLGF), который также является целевым геном HIF, играет важную роль в ангиогенезе в ишемической ткани (Carmeliet, 2004, J Intern Med., 255(5):538-61; Luttun et al., 2002, Ann N Y Acad Sci., 979:80-93). Были продемонстрированы действенные проангиогенные эффекты терапии с повышением экспрессии HIF посредством повышения экспрессии HIF в скелетной мышце (Pajusola et al., 2005, FASEB J., 19(10):1365-7; Vincent et al., 2000, Circulation, 102:2255-61) и в миокарде (Shyu et al., 2002, Cardiovasc Res., 54:576-83). Было также показано привлечение предшественников эндотелиальных клеток к ишемическому миокарду продуктом целевого гена HIF SDF-1 (Abbott et al., 2004, Circulation, 110(21):3300-05). Эти результаты подтверждают общую концепцию, что ингибиторы PHD окажутся эффективны для стимулирования ангиогенеза в условиях ишемии тканей, в частности ишемии мышц. Ожидается, что вызванное ингибиторами PHD терапевтическое развитие кровеносных сосудов будет полезно для восстановления тока крови к тканям и, следовательно, для лечения заболеваний, включая, помимо прочего, следующие: стенокардия, ишемия и инфаркт миокарда, периферическая ишемическая болезнь, перемежающаяся хромота, язва желудка и двенадцатиперстной кишки, неспецифический язвенный колит и воспалительное заболевание кишечника.

PHD и HIF играют центральную роль в восстановлении и регенерации тканей, в том числе в заживлении ран и язв. Последние исследования показали повышенную экспрессию всех трех типов PHD на местах ран у взрослых мышей и, как результат, уменьшение аккумулирования HIF (Chang et al., см. выше). Таким образом, повышение экспрессии HIF у взрослых мышей путем назначения десферриоксамина повышает степень залечивания ран до уровня, наблюдаемого у молодых мышей. Аналогично у мышей, страдающих диабетом, повышение экспрессии HIF было подавлено по сравнению с мышами того же помета без диабета (Mace et al., 2007, Wound Repair Regen., 15(5):636-45). Местное применение имитатора гипоксии хлорида кобальта или повышение экспрессии мышиного HIF с отсутствующим кислородзависимым доменом деградации (ODD), который таким образом обеспечивает постоянно активную форму HIF, приводит к повышению активности HIF на месте раны, повышению экспрессии целевых генов HIF, таких как VEGF, Nos2 и Hmox1, и к ускорению заживления раны. Недавно было показано, что благоприятный эффект ингибирования PHD не ограничивается кожей и что низкомолекулярные ингибиторы PHD также дают положительный результат на моделях мышей с колитом (Robinson et al., 2008, Gastroenterology, 134(1):145-55).

Предполагается, что приводящее к аккумулированию HIF ингибирование PHD включает по меньшей мере четыре механизма действия, каждый из которых вносит свой вклад в ускоренное и более полное заживление ран: 1) защита ткани, подверженной опасности гипоксии и (или) ишемии, 2) стимулирование ангиогенеза для создания или восстановления надлежащего тока крови к месту поражения, 3) привлечение предшественников эндотелиальных клеток к местам поражения, 4) стимулирование выработки факторов роста, которые специфически стимулируют заживление и регенерацию.

Рекомбинантный человеческий фактор роста тромбоцитарный (PDGF) поступает в продажу под названием бекаплермин (Regranexхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 ) и одобрен Управлением по санитарному надзору за качеством пищевых продуктов и медикаментов США для «Лечения диабетических невропатических язв нижних конечностей, которые выходят в подкожную основу или далее и снабжаются кровью в достаточной степени». Было показано, что бекаплермин эффективно ускоряет заживление ран у пациентов, страдающих диабетом (Steed, 2006, Plast Reconstr Surg., 117(7 Suppl):143S-149S; Nagai et al., 2002, Expert Opin Biol Ther., 2(2):211-8). Поскольку PDGF является целевым геном HIF (Schultz et al., 2006, Am J Physiol Heart Circ Physiol., 290(6):H2528-34; Yoshida et al., 2006, J Neurooncol., 76(1):13-21), предполагается, что ингибирование PHD повысит экспрессию эндогенного PDGF и будет оказывать аналогичный или более выраженный благоприятный эффект по сравнению с эффектом приема только бекаплермина. Исследования на животных показали, что местное применение PDGF приводит к повышению количества ДНК, белка и гидроксипролина у раны, формированию более толстого слоя грануляционной и эпидермальной ткани, повышенному клеточному вторичному заселению мест повреждения. PDGF вызывает локальный эффект интенсификации образования новой соединительной ткани. Предполагается, что эффективность ингибирования PHD будет выше, чем эффективность ингибирования, вызванная бекаплермином, из-за дополнительного эффекта защиты ткани и проангиогенного эффекта, опосредуемых HIF.

Ожидается, что благоприятное воздействие ингибирования PHD распространится не только на ускорение заживления ран кожи и толстой кишки, но также на заживление других повреждений ткани, включая, помимо прочего, следующее: желудочно-кишечные язвы, реплантации трансплантата, ожоги, хронические язвы и обморожение.

Стволовые клетки и клетки-предшественники обнаружены в гипоксических нишах внутри тела, и гипоксия регулирует их дифференцирование и судьбу клетки (Simon et al., 2008, Nat Rev Mol Cell Biol., 9:285-96). Таким образом, ингибиторы PHD могут найти применение для поддержания стволовых клеток и клеток-предшественников в плюрипотентном состоянии и стимулирования дифференцировки в клетки требуемого типа. Стволовые клетки могут найти применение для культивирования и роста популяций стволовых клеток и могут удерживать клетки в плюрипотентном состоянии, в то время как в клетки вводятся гормоны и другие факторы для коррекции дифференцировки и судьбы клетки.

Дальнейшее использование ингибиторов PHD в области терапии стволовых клеток и клеток-предшественников связано с использованием ингибиторов PHD для кондиционирования этих клеток, с тем чтобы они выдерживали процесс имплантации в организм и чтобы генерировать соответствующую реакцию организма, в результате чего имплантация стволовой клетки и клетки-предшественника станет осуществимой (Hu et al., 2008, J Thorac Cardiovasc Surg., 135(4):799-808). Более конкретно, ингибиторы PHD могут способствовать интеграции стволовых клеток и привлечению соответствующего кровотока для поддержки стволовых клеток после их встраивания. Эти образованные кровеносные сосуды будут также выполнять функцию переноса гормонов и других высвобожденных этими клетками факторов в остальной организм.

Ингибиторы PHD также могут найти применение при лечении инфекции (Peyssonnaux et al., 2005, J Invest Dermatol., 115(7):1806-15; Peyssonnaux et al., 2008 J Invest Dermatol., август 2008 г.; 128(8):1964-8). Было показано, что повышение экспрессии HIF усиливает врожденную иммунную реакцию на инфекцию в фагоцитах и кератиноцитах. Фагоциты с увеличенным уровнем HIF демонстрируют повышенную бактерицидную активность, повышенную выработку оксида азота и повышенную экспрессию антибактериального пептида кателицидина. Эти эффекты могут быть также полезны для лечения ожоговых инфекций.

Было также показано, что HIF участвует в процессе роста кости и срастания перелома (Pfander D et al., 2003 J Cell Sci., 116(Pt 9):1819-26., Wang et al., 2007 J Clin Invest., 17(6):1616-26.) и, следовательно, может использоваться для лечения или профилактики переломов. HIF стимулирует гликолиз, обеспечивающий энергией синтез внеклеточного матрикса эпифизарных хондроцитов в условиях гипоксии. HIF также играет важную роль в стимуляции выделения VEGF и развитии кровеносных сосудов в процессе срастания перелома. Рост кровеносных сосудов в растущую или срастающуюся кость может быть фактором, ограничивающим скорость процесса восстановления кости.

В литературе описаны некоторые малые молекулы c антагонистической активностью в отношении пролилгидроксилазы. К таким молекулам относятся, помимо прочих, некоторые производные имидазо[1,2-a]пиридина (Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5598-601), замещенные производные пиридина (Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5616-20), некоторые пиразолпиридины (Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5687-90), некоторые бициклические гетероароматические N-замещенные производные глицина (Международная заявка на патент WO2007/103905, 13 сентября 2007 г.), соединения на основе хинолина (Международная заявка на патент WO2007/070359, 21 июня 2007 г.), некоторые барбитурат-N-замещенные производные глицина (Международная заявка на патент WO2007/150011, 27 декабря 2007 г.), замещенные арил- или гетероариламидные соединения (Заявка на патент США US 2007/0299086, 27 декабря 2007 г.) и замещенные 4-гидроксипиримидин-5-карбоксамиды (Международная заявка на патент WO2009/117269, 24 сентября 2009 г.).

Тем не менее, сохраняется необходимость в эффективных модуляторах пролилгидроксилазы с требуемыми фармацевтическими свойствами. Было обнаружено, что в контексте настоящего изобретения некоторые производные хиназолинона обладают модулирующей пролилгидроксилазу активностью.

Краткое описание изобретения

Настоящее изобретение относится к соединениям, которые могут быть использованы в качестве ингибиторов PHD. Соединения, составляющие предмет настоящего изобретения, имеют общую формулу (I),

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

где:

n=от 0 до 3,

R1 представляет собой заместитель, независимо выбираемый из группы, состоящей из галогена, -C1-4 алкила, -C1-4алкинила, -C1-4алкенила, необязательно замещенного галогеном, -CF3, -OCF3, -SCF 3, S(O)CF3, -C(O)-Rc, -C(O)N-R c, -OH, -NO2, -CN, -OC1-4алкила, -SC1-4алкила, -S(O)-C1-4алкила, -SO 2-C1-4алкила, -S-Rc, -S(O)-R c, -SO2-Rc, -SO2N-R c, -O-Rc, -NRaRb, 2,3-дигидробензо[1,4]диоксина, бенз[1,3]диоксола, 1H-индола, бензила, бифенила, необязательно замещенного одним или более Rd, бензилокси, необязательно замещенного одним или более Rd, фенила или моноциклического гетероарила, необязательно замещенного одним или более R d, -C3-8циклоалкила, необязательно замещенного одним или более Rd, -C3-8гетероциклоалкила, необязательно замещенного одним или более Rc, причем две смежные группы R1 могут быть соединены в виде необязательно замещенного 3-8-членного цикла, необязательно замещенного одним или более O, S или N;

Ra и R b независимо выбраны из группы, состоящей из H, C1-4 алкила, -C(O)C1-4алкила, -C(O)-Rc, -C(O)NH-R c, -SO2-Rc, -SO2-C 1-4алкила, фенила, необязательно замещенного Rd , бензила, необязательно замещенного Rd, или моноциклического ароматического гетероцикла, необязательно замещенного Rd ; или Ra и Rb вместе с несущим их атомом азота образуют необязательно замещенный моноциклический гетероциклоалкил, содержащий один или более O, S или N;

Rc представляет собой заместитель, независимо выбранный из группы, состоящей из -C3-8циклоалкила, -C3-8гетероциклоалкила, бифенила, фенила, необязательно замещенного одним или более R d, бензила, необязательно замещенного одним или более R d, нафтила, инданила, 5,6,7,8-тетрагидронафтила и пиридила, необязательно замещенного одним или более Rd;

Rd представляет собой заместитель, независимо выбранный из группы, состоящей из -H, галогена, -OH, -C1-4алкила, -SO2-C1-4алкила, -CN или -CF3 , -OCF3, -OC1-4алкила, -C(O)NH2 , -O-фенила и -O-бензила;

и их фармацевтически приемлемые соли.

Настоящее изобретение также включает изомерные формы соединений формулы (I) и их фармацевтически приемлемые соли, и ссылка в настоящей заявке на одну из таких изомерных форм означает ссылку на по крайней мере одну из таких изомерных форм. Специалист в данной области определит, что соединения в соответствии с данным изобретением могут существовать, например, в единственной изомерной форме, в то время как другие соединения могут существовать в форме региоизомерной смеси.

Настоящее изобретение также относится к фармацевтически приемлемым солям, фармацевтически приемлемым пролекарствам и фармацевтически активным метаболитам соединений формулы (I). В некоторых предпочтительных вариантах осуществления соединение формулы (I) представляет собой соединение, выбираемое из описанных или проиллюстрированных в приведенном ниже подробном описании.

В следующем общем аспекте настоящее изобретение относится к фармацевтическим композициям, каждая из которых включает: (a) эффективное количество соединения формулы (I) или его фармацевтически приемлемой соли, фармацевтически приемлемого пролекарства или фармацевтически активного метаболита; и (b) фармацевтически приемлемый наполнитель.

В другом общем аспекте изобретение направлено на способ лечения пациента с имеющимся или диагностированным заболеванием, расстройством, или медицинским состоянием, опосредуемым активностью фермента пролилгидроксилазы, заключающийся во введении нуждающемуся в таком лечении пациенту эффективного количества соединения формулы (I) или его фармацевтически приемлемой соли, фармацевтически приемлемого пролекарства или фармацевтически активного метаболита.

В некоторых предпочтительных вариантах осуществлениях способа, составляющего предмет настоящего изобретения, упомянутое заболевание, расстройство или медицинское состояние выбрано из: анемии, сосудистых заболеваний, нарушений обмена веществ и заживления раны.

Дополнительные варианты осуществления, особенности и достоинства изобретения станут понятны из следующего ниже подробного описания изобретения и при его практическом применении.

Подробное описание

Настоящее изобретение может быть более полно оценено из нижеследующего описания, включающего глоссарий терминов и заключительные примеры. Для краткости содержимое всех цитируемых в настоящей заявке публикаций, включая патенты, включено в настоящее описание посредством ссылки.

Термины «включающий», «содержащий», «состоящий» используются в настоящем документе в их открытом, неограниченном значении.

Используемый в настоящей заявке термин «алкил» относится к алкильной группе с линейной или разветвленной цепью, содержащей от 1 до 12 атомов углерода. Примеры алкильных групп включают метил (Me, который также может быть структурно обозначен символом «/»), этил (Et), н-пропил, изопропил, бутил, изобутил, втор-бутил, трет-бутил (tBu), пентил, изопентил, трет-пентил, гексил, изогексил и группы, которые в свете общепринятых знаний и изложенных в настоящей заявке представлений могут считаться эквивалентными одному из вышеприведенных примеров.

Используемый в настоящей заявке термин «алкенил» относится к алкенильной группе с линейной или разветвленной цепью, содержащей от 2 до 12 атомов углерода. (Двойная связь алкенильной группы образована между двумя sp2-гибридизированными атомами углерода.) Типичные примеры алкенильных групп включают проп-2-енил, бут-2-енил, бут-3-енил, 2-метилпроп-2-енил, гекс-2-енил и другие аналогичные группы.

Используемый в настоящей заявке термин «алкинил» относится к алкинильной группе с линейной или разветвленной цепью, содержащей от 2 до 12 атомов углерода. (Тройная связь алкинильной группы образована между двумя sp-гибридизированными атомами углерода.) Типичные примеры алкинильных групп включают проп-2-инил, бут-2-инил, бут-3-инил, 2-метилпроп-2-инил, гекс-2-инил и другие аналогичные группы.

Используемый в настоящей заявке термин «циклоалкил» означает насыщенный или частично насыщенный моноциклический, конденсированный полициклический или спиро-полициклический карбоцикл, содержащий от 3 до 12 кольцевых атомов на карбоцикл. Типичные примеры циклоалкильных групп включают следующие группы в форме соответствующим образом связанных фрагментов:

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Используемый в настоящей заявке термин «гетероциклоалкил» относится к моноциклической кольцевой структуре, которая является насыщенной или частично насыщенной, или моноциклу конденсированной полициклической системы; гетероциклоалкил содержит в цикле от 3 до 8 атомов, представленных атомами углерода и не более чем двумя гетероатомами, такими как азот, кислород и сера. Кольцевая структура может также дополнительно содержать до двух оксогрупп, присоединенных к атомам серы кольца. Типичные примеры гетероциклоалкильных групп включают следующие группы в форме соответствующим образом связанных фрагментов:

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Используемый в настоящей заявке термин «гетероарил» означает моноциклический, конденсированный бициклический или конденсированный полициклический ароматический гетероцикл (кольцевую структуру, атомы кольца которой выбираются из атомов углерода и до четырех гетероатомов, выбираемых из азота, кислорода и серы), содержащий от 3 до 12 кольцевых атомов на гетероцикл. Типичные примеры гетероарильных групп включают следующие группы в форме соответствующим образом связанных фрагментов:

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Специалисты определят, что перечисленные или проиллюстрированные выше примеры циклоалкильных, гетероциклоалкильных и гетероарильных групп не являются исчерпывающими, и что в рамках определенных условий настоящего изобретения могут быть выбраны и иные группы указанных типов.

Используемый в настоящей заявке термин «галоген» означает хлор, фтор, бром или йод. Используемый в настоящей заявке термин «гало» означает хлор, фтор, бром и йод.

Используемый в настоящей заявке термин «замещенный» означает, что указанная функциональная группа или фрагмент имеет один или несколько заместителей. Используемый в настоящей заявке термин «незамещенный» означает, что указанная группа не имеет заместителей. Используемый в настоящей заявке термин «необязательно замещенный» означает, что указанная группа либо не имеет заместителей, либо несет один или более заместителей. Если термин «замещенный» используется для описания структурной системы, это значит, что замещение происходит в любом положении системы, допускаемом валентностью. В тех случаях, когда для определенного фрагмента или группы явно не указано, что она является необязательно замещенной или замещенной некоторым конкретным заместителем, подразумевается, что такой фрагмент или группа является незамещенной.

Каждая из приведенных в настоящей заявке формул представляет как соединения со структурами, показанными данной структурной формулой, так и некоторые вариации или формы подобных структур. В частности, соединения любой приведенной в настоящем документе формулы могут иметь асимметрические центры и, следовательно, существовать в различных энантиомерных формах. Все оптические изомеры и стереоизомеры соединений указанной общей формулы, а также смеси таковых, рассматриваются в рамках данной формулы. Таким образом, любая приведенная в настоящей заявке формула предназначена для обозначения рацемата, одной или более энантиомерных форм, одной или более диастереомерных форм, одной или более атропизомерных форм, а также их смесей. Кроме того, некоторые структуры могут существовать в форме геометрических изомеров (например, цис- и транс-изомеров), таутомеров или атропизомеров. Кроме того, любая приведенная в настоящей заявке формула включает гидраты, сольваты и полиморфы таких соединений, а также их смеси.

Кроме того, каждая приведенная в настоящей заявке формула, помимо собственно соединений, также включает их гидраты, сольваты и полиморфы, а также их смеси, даже если такие формы не указаны явно. Некоторые соединения формулы (I) или фармацевтически приемлемые соли соединений формулы (I) могут быть получены в виде сольватов. Сольваты включают формы, образуемые в результате взаимодействия или комплексообразования соединений, составляющих предмет настоящего изобретения, с одним или более растворителем, либо в виде раствора, либо в виде твердой или кристаллической формы. В ряде вариантов осуществления упомянутый растворитель представляет собой воду, а сольваты являются гидратами. Кроме того, некоторые кристаллические формы соединений формулы (I) или фармацевтически приемлемых солей соединений формулы (I) могут быть получены в виде со-кристаллов. В некоторых вариантах осуществления настоящего изобретения соединения формулы (I) были получены в кристаллической форме. В других вариантах осуществления кристаллические формы соединений формулы (I) были кубическими по своей природе. В других вариантах осуществления фармацевтически приемлемые соли соединений формулы (I) были получены в кристаллической форме. В других вариантах осуществления соединения формулы (I) были получены в виде одной из нескольких полиморфных форм, в виде смеси кристаллических форм, в виде полиморфной формы или в аморфном виде. В других вариантах осуществления соединения формулы (I) в растворе переходят из одной кристаллической и (или) полиморфной формы в другую и обратно.

Для большей сжатости описания ряд приводимых в настоящей заявке количественных выражений дается без модификатора «приблизительно». Подразумевается, что независимо от того, указывается ли модификатор «приблизительно» явным образом или нет, каждое приводимое в настоящей заявке численное значение относится к конкретному приведенному значению, а также к приближению к данному приведенному значению, которое может быть разумным образом оценено любым специалистом, включая эквиваленты и приближения, связанные с условиями проведения эксперимента и (или) измерения для подобного приведенного значения. При указании выхода соединения в процентах приводимый выход относится к массе структурной единицы, для которой указывается выход, по отношению к максимально достижимому количеству данной структурной единицы в конкретных стехиометрических условиях. Если не указано иное, все приводимые в процентах концентрации относятся к массовым соотношениям.

Упоминание химической структурной единицы в настоящей заявке означает отсылку к любому из следующего: (а) буквально указанной форме данной химической структурной единицы, и (b) любой форме упомянутой химической структурной единицы в той среде, где данное соединение находится на момент упоминания. Например, упоминание в настоящей заявке такого соединения, как R-COOH, включает отсылку к любой из, например, следующих форм: R-COOH(s), R-COOH(sol) и R-COO- хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 (sol). В приведенном примере, R-COOH(s) относится к твердому соединению, например, в виде таблетки или иной твердой фармацевтической форме или композиции; R-COOH (sol) относится к недиссоциированной форме соединения в растворителе; и R-COO-хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 (sol) относится к диссоциированной форме соединения в растворителе, такой как диссоциированная форма соединения в водной среде, независимо от того, получена ли данная диссоциированная форма из R-COOH, из его соли или из любой другой структурной единицы, которые дают R-COO- при диссоциации в рассматриваемой среде. В другом примере такое выражение, как «действие на структурную единицу соединением по формуле R-COOH» означает действие на упомянутую структурную единицу формой или формами соединения R-COOH, которая существует или которые существуют в той среде, где осуществляется описываемое воздействие. В еще одном примере такое выражение, как «введение структурной единицы в реакцию с соединением по формуле R-COOH», относится к реакции (а) подобной структурной единицы в соответствующей химической форме или формах, которая существует или которые существуют в той среде, где осуществляется описываемая реакция, с (b) соответствующей химической формой или формами соединения R-COOH, которая существует или которые существуют в той среде, где осуществляется описываемая реакция. В этой связи, если подобная структурная единица находится, например, в водной среде, подразумевается, что упомянутое соединение R-COOH находится в той же среде, и поэтому на упомянутую структурную единицу действуют такие агенты, как R-COOH(aq) и (или) R-COO-хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 (aq), где нижний индекс «(aq)» означает «водный» в соответствии с его общепринятым значением в химии и биохимии. В описанных примерах используемой номенклатуры применяется карбоксильная функциональная группа, однако этот выбор ни в коей мере не является ограничением и был сделан только для иллюстрации. Подразумевается, что аналогичные примеры могут быть приведены и для иных функциональных групп, включая, помимо прочего, такие группы, как гидроксильная группа, азотная основная группа, например, в аминах, а также любые другие группы, которые известным образом взаимодействуют или перестраиваются в содержащей данное соединение среде. Подобные взаимодействия и перестройки включают в себя, помимо прочего, диссоциацию, ассоциацию, таутомеризм, сольволиз, включая гидролиз, сольватацию, включая гидратацию, протонирование и депротонирование.

В другом примере цвиттерионное соединение в настоящей заявке включается путем отсылки к соединению, которое может образовывать цвиттерион, даже если оно явно не упоминается в своей цвиттерионной форме. Термины «цвиттерион», «цвиттерионы», а также их синонимы «цвиттерионное соединение» и «цвиттерионные соединения» являются стандартными рекомендованными IUPAC терминами, которые хорошо известны и входят в стандартный набор определенных научных терминов. В этой связи термину «цвиттерион» присвоен уникальный идентификатор CHEBI:27369 в Словаре химических объектов биологического интереса (ChEBI). Как в целом хорошо известно, цвиттерион или цвиттерионное соединение представляет собой в целом нейтральное соединение, имеющее формальные единичные заряды противоположных знаков. Иногда к подобным соединениям также применяется термин «внутренние соли». В ряде источников такие соединения называются «диполярными ионами», хотя в других источниках последний термин считается неправильным. В качестве конкретного примера, аминоэтановая кислота (аминокислота глицин) имеет формулу H2NCH2COOH и в ряде сред (в данном случае в нейтральной среде) существует в форме цвиттериона +H3NCH2COO- . Цвиттерионы, цвиттерионные соединения, внутренние соли и диполярные ионы в известных и хорошо обоснованных значениях перечисленных терминов относятся к сфере действия настоящего изобретения, как без труда определят специалисты. Поскольку нет необходимости называть каждый отдельный вариант осуществления настоящего изобретения, который может определить специалист, в настоящей заявке не приводятся явно структуры цвиттерионных соединений, родственных соединениям, составляющим предмет настоящего изобретения. Тем не менее, все такие структуры являются частью вариантов осуществления настоящего изобретения. В настоящей заявке не приводятся дальнейшие примеры в этой связи, поскольку возможные взаимодействия и перестройки в каждой конкретной среде, приводящие к различным формам каждого конкретного соединения, хорошо известны специалистам.

Каждая из приведенных в настоящей заявке формул также представляет как немеченые, так и изотопно-меченые формы соответствующих соединений. Изотопно-меченые соединения имеют структуры, соответствующие представленным в настоящей заявке формулам, за исключением того, что один или более атомов в них заменены атомом, имеющим определенную атомную массу или массовое число. Примеры изотопов, которые могут быть введены в соединения настоящего изобретения, включают изотопы водорода, углерода, азота, кислорода, фосфора, фтора, хлора и йода, такие как 2H, 3H, 11C, 13C, 14C, 15N, 18 O, 17O, 31P, 32P, 35 S, 18F, 36Cl, 125I, соответственно. Такие меченые изотопами соединения могут найти применение для исследований метаболизма (предпочтительно с 14C), исследований кинетики реакций (например, с 2H или 3H), в методиках обнаружения или получения изображений [таких как позитронная эмиссионная томография (PET) или однофотонная эмиссионная компьютерная томография (SPECT)], включая количественные анализы распределения лекарства или субстрата в тканях, или при радиационной терапии пациентов. В частности, соединения, меченые 18F или 11C, могут оказаться особенно предпочтительны для исследований способами PET или SPECT. Кроме того, замещение более тяжелыми изотопами, такими как дейтерий (т.е. 2 H), может дать определенные терапевтические преимущества вследствие большей метаболической стабильности соединений, например, увеличенного периода полувыведения in vivo или снижения необходимой дозировки. Изотопно-меченые соединения настоящего изобретения и их пролекарства могут, в целом, быть получены путем проведения процедур согласно описанным ниже схемам или примерам и способам получения, путем замены не содержащего меченых атомов реагента на легкодоступный реагент с мечеными атомами.

В качестве первого примера по используемой для обозначения заместителей терминологии, если заместитель S1хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой один из S1 и S2, и заместитель S2хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой один из S3 и S4, то указанные варианты обозначения заместителей включают варианты осуществления настоящего изобретения в соответствии со следующими наборами: S1хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S1 и S 2хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S3; S 1хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S1 и S 2хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S4; S 1хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S2 и S 2хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S3; S 1хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S2 и S 2хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой S4; а также эквивалентны каждого из перечисленных наборов заместителей. Поэтому для краткости изложения без ограничения общности в настоящей заявке используется сокращенная терминология: «S1 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой один из S1 и S2, а S2хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пример представляет собой один из S3 и S4». Приведенный выше первый пример по используемой для обозначения заместителей терминологии, данный в общих терминах, иллюстрирует различные варианты обозначения заместителей, описанные в настоящей заявке. Приведенный выше принцип обозначения заместителей распространяется, если применимо, на такие группы, как R 1, R2, A, X4, X5, X 6, X7, Ra, Rb, Rc , Rd, Re, Rf и Rg , а также на любые другие общие символические обозначения заместителей, используемые в настоящей заявке.

Кроме того, если для любого участника химической структуры или заместителя приводится более чем один вариант, варианты осуществления настоящего изобретения включают различные независимые сочетания вариантов из списков возможных заместителей, а также их эквиваленты. В качестве второго примера по используемой для обозначения заместителей терминологии, если в настоящей заявке указано, что заместитель Sпример представляет собой один из S1, S2 и S 3, данный перечень включает варианты осуществления настоящего изобретения, в которых Sпример представляет собой S1; Sпример представляет собой S2 ; Sпример представляет собой S3; S пример представляет собой один из S1 и S 2; Sпример представляет собой один из S 1 и S3; Sпример представляет собой один из S2 и S3; Sпример представляет собой один из S1, S2 и S3; и Sпример представляет собой любой эквивалент каждого из перечисленных вариантов. Поэтому для краткости изложения без ограничения общности в настоящей заявке используется сокращенная терминология: «Sпример представляет собой один из S1, S2 и S3». Приведенный выше второй пример по используемой для обозначения заместителей терминологии, данный в общих терминах, иллюстрирует различные варианты обозначения заместителей, описанные в настоящей заявке. Приведенный выше принцип обозначения заместителей распространяется, если применимо, на такие группы, как R1, R2 , A, X4, X5, X6, X7 , Ra, Rb, Rc, Rd, Re, Rf и Rg, а также на любые другие общие символические обозначения заместителей, используемые в настоящей заявке.

Номенклатура «Ci-j », где j>i, используемая в настоящей заявке для обозначения класса заместителей, включает варианты осуществления настоящего изобретения, для которых индивидуально реализовано каждое и все возможные количества атомов углерода, от i до j, включая i и j. В качестве примера термин C1-3 относится независимо к вариантам осуществления, в которых имеется один атом углерода (C1), вариантам осуществления, в которых имеются два атома углерода (C2), и вариантам осуществления, в которых имеются три атома углерода (C3).

Используемый в настоящей заявке термин Cn-mалкил означает линейную или разветвленную алифатическую цепь с полным количеством N углеродных центров в цепи, удовлетворяющим условию nхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Nхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 m, где m>n.

Любое упоминание в настоящей заявке дивалентного заместителя включает различные варианты присоединения упомянутого заместителя, если имеется более одной такой возможности. Например, упоминание дивалентного заместителя -A-B-, где Aхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 B, в настоящей заявке относится к таким дивалентным заместителям -A-B-, где фрагмент A присоединяется к первому замещаемому центру и фрагмент B присоединяется ко второму замещаемому центру, а также к таким дивалентным заместителям -A-B-, где фрагмент A присоединяется ко второму замещаемому центру и фрагмент B присоединяется к первому замещаемому центру.

В соответствии с приведенными выше соображениями по обозначению заместителей и используемой номенклатуре подразумевается, что в настоящей заявке явное упоминание некоторого набора возможностей означает, при наличии химического смысла и если не указано иное, независимую отсылку ко всем возможным вариантам осуществления данного набора, а также отсылку ко всем и каждому возможному варианту осуществления подмножеств явно указанного набора возможных вариантов.

Изображения химических структур предназначены для детального представления тех частей соединений, которые содержат описанные здесь ориентации.

Настоящее изобретение включает применение соединений формулы (I),

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

применение соединений формулы (I) и содержащих такие соединения фармацевтических композиций, для лечения пациентов (людей или иных млекопитающих), имеющих заболевания, связанные с модуляцией фермента пролилгидроксилазы. Настоящее изобретение также включает способы получения такого соединения, его фармацевтической композиции, фармацевтически приемлемой соли, фармацевтически приемлемого пролекарства и фармацевтически активных метаболитов.

В настоящем изобретении описывается соединение формулы (I), где n равно от 0 до 3, а R1 независимо представляют собой галоген, гидроксил, алкил, алкенил, алкинил, алкокси, тиоалкил, алкил сульфоксид, алкил сульфон, необязательно замещенные 3-8 членные алифатические, ароматические или гетероциклические фрагменты, амино, алкиламино, алкилсульфонамид, арилсульфонамид, нитро, циано, -SCF3, замещенный фенокси, бензилокси, замещенный диарил, замещенный арилсульфон, замещенный арилсульфоксид или замещенный арилсульфонил.

В следующих предпочтительных вариантах осуществления n равно от 1 до 2, R1 независимо представляет собой галоген, алкил C1-4с линейной или разветвленной цепью, трифторалкокси-группу с линейной или разветвленной цепью C1-4, трифторалкильную группу с линейной или разветвленной цепью C1-4 или моноциклический насыщенный или частично насыщенный C3-8 карбоцикл.

В некоторых других предпочтительных вариантах осуществления две соседних группы R1 могут быть соединены с образованием необязательно замещенного 3-8-членного насыщенного или ненасыщенного карбоциклического или гетероциклического кольца.

В некоторых других предпочтительных вариантах n=2, и R1 независимо представляет собой галоген, C 1-4алкил, -CF3, -OCF3, замещенный фенокси и необязательно замещенный 3-8 членный ароматический карбоцикл.

В следующих предпочтительных вариантах осуществления n равно 1, и R1 представляет собой необязательно замещенную фенокси-группу, содержащую от одного до трех галогенов; -C1-4алкил или -C1-4алкокси-группу; фенилсульфанил, необязательно замещенный от одного до трех галогенами; -C 1-4алкил или -C1-4алкокси-группу; циклогексил; хлор; фтор; йод; -OCF3 и -CF3.

В некоторых других предпочтительных вариантах осуществления от одного до трех R1 независимо выбраны из группы, состоящей из хлора, фтора, брома, йода, -NO2, -OH, -CF3 , -CH3, -CH2CH3, -CH2 CH2CH3, -OCF3, -OCH3 , -OCH2CH3, -SCH3, -SCF 3, -S(O)CF3, -SO2CH3, -NH2, -N(CH3)2, -NH(CH2 CH3), циано, изопропокси, изопропила, втор-бутила, трет-бутила, этинила, 1-хлорвинила, 4-метилпиперазинила, морфолин-4-ила, пирролидинила, пирролидин-1-карбонила, пиперидинила, фенила, бензила, дифенила, толила, фенокси, циклопропила, циклогексила, фенилсульфанила, 3,4-диметоксифенилсульфанила, 4-трет-бутилфенилсульфанила, 7-пиперидинила, 2,6-диметилфенокси, 3,4,5-триметоксифенокси, нафталин-1-илокси, нафталин-2-илокси, 5,6,7,8-тетрагидронафталин-1-илокси, индан-5-илокси, 3-хлорфенокси, 4-хлорфенокси, 2,3-дихлорфенокси, 3-метоксифенокси, 4-фторфенокси, 2-фторфенокси, 3-фторфенокси, 3,5-ди-трет-бутилфенокси, 3-метилфенокси, 2,6- дихлорфенокси, 2,5-дихлорфенокси, 4-метоксифенокси, пиридин-3-илокси, тетрагидропиран-4-ила, 3,4-дигидро-1Н-изохинолин-2-ила, 7-бром-3, 4-дигидро-1Н-изохинолин-2-ила, 3-метоксифенилпиперидинила и бензолсульфонила.

В следующих предпочтительных вариантах осуществления n=1.

В следующих предпочтительных вариантах осуществления n=2.

В следующих предпочтительных вариантах осуществления n=3.

В следующих предпочтительных вариантах осуществления -RaRb независимо выбран из группы, состоящей из -H, -CH3, -CH2CH3, бензоила, 2,6-диметилбензоила, ацетил-C(O)NH-фенила, бензолсульфонила, метансульфонила, бензила, 2-метилбензила, 2-хлорбензила, 2,6-диметилбензила, 2,6-дифторобензила, 2-цианобензила, 3-цианобензила, 3-карбамоилбензила, 2,6-дихлорбензила, 3-хлорбензила и 4-метилбензила.

В следующих предпочтительных вариантах осуществления Ra и Rb вместе с несущим их атомом азота могут образовывать необязательно замещенный N-метилпиперазин-1-ил, 3,4-дигидро-1Н-изохинолин-2-ил, пиперидинил, морфолин-4-ил и пирролидинил.

В следующих предпочтительных вариантах осуществления Rc независимо выбран из группы, состоящей из фенила, циклогексила, 4-трет-бутилфенила, 3,4-диметоксифенила, 2,6-диметилфенила, 3,4,5-триметоксифенила, нафталин-1-ила, 3-хлорфенила, 4-хлорфенила, 3-метоксифенила, 4-фторфенила, 2-фторфенила, 3-фторфенила, 3,5-ди-трет-бутилфенила, 4-оксо-6-м-толила, 4-оксо-6-о-толила, 2,6-дихлорфенила, 2,4-дихлорфенила, 2,5-дихлорфенила, 4-метоксифенила, 2,6-диметилфенила, нафталин-2-ила, 5,6,7,8-тетрагидронафталин-1-ила, 4-хлорфенила, п-толила, индан-5-ила, 2,3-дихлорфенила и пиридин-3-ила.

В следующих предпочтительных вариантах осуществления Rd независимо выбран из группы, состоящей из -H, хлора, фтора, брома, йода, -C1-4алкила, -CF3, -OCF3, -OC 1-4алкила, фенила, -O-фенила или -О-бензила.

В некоторых предпочтительных вариантах осуществления изобретения соединения формулы (I) выбраны из группы, состоящей из следующих соединений:

ПримерХимическое название
11-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
2 1-(7-трифторметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;

31-(6,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
4 1-(6-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
5 1-(6,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
6 1-(5-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
7 1-(8-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
8 1-(6-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
9 1-(8-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
10 1-(7-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
11 1-(8-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
12 1-(6-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
13 1-(6-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
14 1-(8-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
15 1-(4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
16 1-(4-оксо-8-трифторметил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
17 1-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
18 1-(5,6,7-триметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
19 1-(6-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;

201-(4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
21 1-(6-циклогексил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
22 1-(7-хлор-4-оксо-8-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
23 1-(1-оксо-2,7-дигидро-1H-пирроло[3,2-f]хиназолин-3-ил)-1Н-пиразол-4-карбоновая кислота;
24 1-[6-(4-трет-бутилфенилсульфанил)-7-хлор-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
25 1-(7-хлор-4-оксо-6-фенилсульфанил-1,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
26 1-[7-хлор-6-(3,4-диметоксифенилсульфанил)-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
27 1-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
28 1-[4-оксо-6-(3,4,5-триметоксифенокси) -3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
29 1-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
30 1-[6-(3-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
31 1-[6-(3-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
32 1-[6-(4-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
33 1-[6-(2-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
34 1-[6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
35 1-[6-(3,5-ди-трет-бутилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
36 1-(4-оксо-6-м-толилокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
37 1-(4-оксо-6-о-толилокси-3,4-дигидрохиназолин-2-ил)-1Н-

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пиразол-4-карбоновая кислота;
381-[6-(2,6-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
39 1-[6-(2,4-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
40 1-[6-(2,5-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
41 1-[6-(4-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
42 1-[6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
43 1-[6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
44 1-[4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
46 1-[6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
47 1-(4-оксо-6-п-толилокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
48 1-[7-хлор-6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
49 1-[7-хлор-6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
50 1-[6-(2,6-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
51 1-[6-(2,6-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
52 1-[7-фтор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
53 1-[7-хлор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
54 1-[7-хлор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
55 1-[7-хлор-4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 карбоновая кислота;
561-[7-фтор-6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
57 1-[7-фтор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
58 1-[7-фтор-6-(индан-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
59 1-(7-метил-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
60 1-[6-(2,3-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
61 1-[6-(2,6-диметилфенокси)-7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
62 1-(7-метокси-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
63 1-[6-(2,6-диметилфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
64 1-(5,7-дифтор-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
65 1-[4-оксо-6-(пиридин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
66 1-(4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
67 соль 1-[4-оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновой кислоты и трис(гидроксиметил)аминометана;
681-(7-хлор-4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
69 1-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
70 1-(6-дифенил-3-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
71 1-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
72 1-[6-(4-трет-бутилбензолсульфонил)-7-хлор-4-оксо-3,4-

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
73 1-(7,7-диметил-4-оксо-3,7-дигидро-4Н-8-окса-1,3-диазаантрацен-2-ил)-1Н-пиразол-4-карбоновая кислота;
74 1-(4-оксо-6-феноксиметил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
75 1-[6-(2,6-диметилфеноксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
76 1-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
77 1-[6-(1-хлорвинил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
78 1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
79 1-[7-(4-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
80 1-[7-(2-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
81 1-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
82 1-[7-(4-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
83 1-[7-(2-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
84 1-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
85 1-[6-(7-бром-3,4-дигидро-1Н-изохинолин-2-ил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
86 (rac)-1-{7-хлор-6-[3-(3-метоксифенил)-пиперидин-1-ил]-4-оксо-3,4-дигидрохиназолин-2-ил}-1H-пиразол-4-карбоновая кислота;
87 1-[6-(2,5-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;

881-[6-(3,4-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
89 1-[6-(3,5-диметилфенокси)-7-метил-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
90 1-[6-(2,5-дихлорфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
91 1-[6-(дифенил-3-илокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
92 1-[6-(3,4-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
93 1-[7-метил-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
94 1-[6-(3,5-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
95 1-[7-фтор-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
96 1-[6-(2-фтор-3-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
97 1-[6-(3-фтор-5-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
98 1-[6-(3,5-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
99 1-[6-(дифенил-3-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
100 1-[4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
101 1-[6-(2,6-дихлорфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
102 1-(6-циклогексилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
103 1-[6-(4-метилпиперазин-1-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
104 1-(6-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;

1051-(6-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
106 1-(4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
107 1-(6-морфолин-4-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
108 1-[6-(1Н-индол-6-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
109 1-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
110 1-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
111 1-(4-оксо-8-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
112 1-(4-оксо-8-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
113 1-(4-оксо-8-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
114 1-(8-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
115 1-(8-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
116 1-(5,8-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
117 1-(4-оксо-8-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
118 1-(8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
119 1-(6-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
120 1-(6-втор-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
121 1-(6-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;

1221-(6-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
123 1-(4-оксо-6-пирролидин-1-ил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
124 1-(4-оксо-6-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
125 1-(6-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
126 1-(4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
127 1-(6-бром-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
128 1-(6-этил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
129 1-(4-оксо-6-пропил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
130 1-(6-бром-8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
131 1-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
132 1-(5,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
133 1-(7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
134 1-(7-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
135 1-(7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
136 1-(7-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
137 1-(4-оксо-3,4,8,9-тетрагидро-7H-6,10-диокса-1,3-диазациклогепта[b]нафталин-2-ил)-1H-пиразол-4-карбоновая кислота;
138 1-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновая кислота;

1391-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
140 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота;
141 1-(6-оксо-2,3,6,7-тетрагидро-1H-7,9-диазациклопента[a]нафталин-8-ил)-1H-пиразол-4-карбоновая кислота;
142 1-(4-оксо-3,4,7,8,9,10-гексагидробензо[h]хиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
143 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота;
144 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1Н-пиразол-4-карбоновая кислота;
145 1-(5,7-диметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
146 1-(7-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
147 1-(7-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
148 1-(4-оксо-7-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
149 1-(7-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
150 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
151 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
152 1-(7-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
153 1-(6-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
154 1-(7-гидрокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
155 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;

1561-(4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
157 1-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
158 1-(7-хлор-6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
159 1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
160 1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
161 1-[4-оксо-6-(пирролидин-1-сульфонил)-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;
162 1-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;
163 1-[6-(2,6-диметилфенилкарбамоил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;
164 1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота
165 1-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
166 1-[6-(2,6-диметилбензоиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
167 1-(6-ацетиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
168 1-[4-оксо-6-(3-фенилуреидо)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
169 1-(6-бензолсульфониламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
170 1-(6-метансульфонамино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
171 1-(6-бензиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
172 1-(6-этиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;

1731-[6-(2-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
174 1-[6-(2-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
175 1-[6-(2,6-диметилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
176 1-[6-(2,6-дифторбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
177 1-[6-(2-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
178 1-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
179 1-[6-(3-карбамоилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
180 1-(6-амино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
181 1-[6-(2,6-дихлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
182 1-[6-(3-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
183 1-[6-(4-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
184 1-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
185 1-[7-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
186 1-[7-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
187 1-[7-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
188 1-(4-оксо-7-о-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
189 1-(4-оксо-7-м-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;

1901-(4-оксо-6-м-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
191 1-(4-оксо-6-п-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
192 1-[6-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
193 1-[6-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
194 1-[6-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
195 1-[6-(2-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
196 1-[6-(3-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
197 1-[6-(4-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
198 1-[6-(2-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
199 1-[6-(3-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
200 1-[6-(4-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
201 1-[4-оксо-6-(2-трифторметилфенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
202 1-[4-оксо-6-(2-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
203 1-[6-(2-этилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
204 1-[6-(2,3-дигидробензо[1,4]диоксин-5-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;
205 1-[4-оксо-6-(3-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;
206 1-[6-(3-метансульфонилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;

2071-(6-бензо[1,3]диоксол-5-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
208 1-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
209 1-(6-бензолсульфинил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
210 1-(6-бензолсульфонил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота; и
211 1-(4-оксо-6-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота.

а также их фармацевтически приемлемые соли.

Настоящее изобретение включает также фармацевтически приемлемые соли соединений формулы (I), предпочтительно из тех, которые описаны выше, и из тех указанных соединений, примеры которых приведены в настоящей заявке, и способы лечения с использованием таких солей.

Используемый в настоящей заявке термин «фармацевтически приемлемая соль» означает соль свободной кислоты или основания соединения, представленного формулой (I), которая является нетоксичной, биологически переносимой или иным образом биологически допустимой для назначения пациенту. См., в общем, G.S. Paulekuhn et al., «Trends in Active Pharmaceutical Ingredient Salt Selection based on Analysis of the Orange Book Database», J. Med. Chem., 2007, 50:6665-72, S.M. Berge, et al., «Pharmaceutical Salts», J Pharm Sci., 1977, 66:1-19, and Handbook of Pharmaceutical Salts, Properties, Selection, and Use, Stahl and Wermuth, Eds., Wiley-VCH and VHCA, Zurich, 2002. Примеры фармацевтически приемлемых солей включают фармакологически эффективные соли, которые могут контактировать с тканями пациента, не вызывая неприемлемой токсичности, раздражения или аллергической реакции. Соединение формулы (I) может иметь в достаточной степени кислую группу, в достаточной степени основную группу или оба типа функциональных групп и вступать в соответствующие реакции с рядом неорганических или органических оснований, а также неорганических или органических кислот с образованием фармацевтически приемлемых солей.

Примеры фармацевтически приемлемых солей включают следующие соли: сульфаты, пиросульфаты, бисульфаты, сульфиты, бисульфиты, фосфаты, моногидрофосфаты, дигидрофосфаты, метафосфаты, пирофосфаты, хлориды, бромиды, йодиды, ацетаты, пропионаты, деканоаты, каприлаты, акрилаты, форматы, изобутираты, капроаты, гептаноаты, пропиолаты, оксалаты, малонаты, сукцинаты, субераты, себакаты, фумараты, малеаты, бутин-1,4-диоаты, гексин-1,6-диоаты, бензоаты, хлорбензоаты, метилбензоаты, динитробензоаты, гидроксибензоаты, метоксибензоаты, фталаты, сульфонаты, ксиленсульфонаты, фенилацетаты, фенилпропионаты, фенилбутираты, цитраты, лактаты, хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 -гидроксибутираты, гликоляты, тартраты, метансульфонаты, пропансульфонаты, нафталин-1-сульфонаты, нафталин-2-сульфонаты и манделаты.

Когда соединение формулы (I) содержит основный атом азота, искомая фармацевтически приемлемая соль может быть получена по любой соответствующей известной методике, включая следующие способы: обработка свободного основания неорганической кислотой, такой как хлористоводородная кислота, бромистоводородная кислота, серная кислота, сульфаминовая кислота, азотная кислота, борная кислота, фосфорная кислота, и так далее, или органической кислотой, такой как уксусная кислота, фенилуксусная кислота, пропионовая кислота, стеариновая кислота, молочная кислота, аскорбиновая кислота, малеиновая кислота, гидроксималеиновая кислота, изэтионовая кислота, янтарная кислота, валериановая кислота, фумаровая кислота, малоновая кислота, пировиноградная кислота, щавелевая кислота, гликолевая кислота, салициловая кислота, олеиновая кислота, пальмитиновая кислота, лауриновая кислота, пираносидиловая кислота, такая как глюкуроновая кислота или галактуроновая кислота, альфа-гидрокси кислота, такая как миндальная кислота, лимонная кислота, или винная кислота, аминокислота, такая как аспарагиновая кислота, глутаровая кислота или глутаминовая кислота, ароматическая кислота, такая как бензойная кислота, 2-ацетоксибензойная кислота, нафтойная кислота или коричная кислота, сульфоновая кислота, такая как лаурилсульфоновая кислота, пара-толуолсульфоновая кислота, метансульфоновая кислота, этансульфоновая кислота, любая совместимая смесь кислот, например тех, которые приведены в настоящей заявке в качестве примеров, и любая другая кислота или смесь таковых, которые рассматриваются как эквивалентные или приемлемые заменители в свете обычного уровня знаний в данной технологии.

Когда соединение формулы (I) является кислотой, такой как карбоновая кислота или сульфоновая кислота, искомая фармацевтически приемлемая соль может быть получена по любой соответствующей методике, включая следующие способы: обработка свободной кислоты неорганическим или органическим основанием, таким как амин (первичный, вторичный или третичный), гидроксид щелочного металла, гидроксид щелочноземельного металла, любая совместимая смесь оснований, таких как приведенные в настоящей заявке в примерах, и любого иного основания и смеси таковых, которые рассматриваются как эквивалентные или приемлемые заменители в свете обычного уровня знаний в данной технологии. Типичные примеры соответствующих солей включают органические соли, полученные из аминокислот, таких как N-метил-D-глюкамин, лизин, холин, глицин и аргинин, аммониевые соли, карбонаты, бикарбонаты, соли первичных, вторичных и третичных аминов и циклических аминов, таких как трометамин, бензиламины, пирролидины, пиперидин, морфолин и пиперазин, и неорганические соли - производные натрия, кальция, калия, магния, марганца, железа, меди, цинка, алюминия и лития.

Примеры пролекарств включают соединения, имеющие аминокислотный остаток или полипептидную цепочку из двух или более (например, два, три или четыре) аминокислотных остатков, ковалентно связанных амидной или эфирной связью со свободной амино-, гидрокси-, или карбокси-группой соединения формулы (I). Примеры аминокислотных остатков включают двадцать существующих в природе аминокислот, которые обычно обозначаются тремя буквами, а также 4-гидроксипролин, гидроксилизин, демозин, изодемозин, 3-метилгистидин, норвалин, бета-аланин, гамма-аминомасляную кислоту, цитруллин гомоцистеин, гомосерин, орнитин и метионинсульфон.

Дополнительные типы пролекарств могут быть получены, например, при использовании свободных карбоксильных групп структур по формуле (I) для получения амидных или алкилэфирных производных. Примеры амидов включают производные аммония, первичных C 1-6алкиламинов и вторичных ди(C1-6алкил)аминов. Вторичные амины включают фрагменты с 5- или 6-членным гетероциклоалкильным или гетероарильным кольцом. Примеры амидов включают производные аммония, первичных C1-3алкиламинов и ди(C1-2 алкил)аминов. Примеры сложных эфиров настоящего изобретения включают C1-7алкил, C5-7циклоалкил, фенил и фенил(C 1-6алкил) эфиры. Предпочтительные сложные эфиры включают метиловые эфиры. Пролекарства также могут быть получены фукционализацией свободных гидроксильных групп для получения замещенных производных, включая гемисукцинаты, фосфатные эфиры, диметиламиноацетаты и фосфорилоксиметилоксикарбонилы, следуя процедурам, описанным в Fleisher et al., Adv. Drug Delivery Rev. 1996, 19, 115-130. Для получения пролекарств могут также использоваться карбаматные производные гидроксильных и аминогрупп. Для получения пролекарств могут также использоваться карбонатные производные, сульфонатные эфиры и сульфатные эфиры гидроксигрупп. Также для получения пролекарств возможно использование гидроксигрупп, таких как (ацилокси)метил- и (ацилокси)этил эфиры, где ацильная группа может быть алкилэфиром, необязательно замещенным одним или более эфирными, амино или карбоксильными функциональными группами, или где упомянутая ацильная группа представляет собой эфир аминокислоты, как описано выше. Пролекарства этого типа могут быть получены в соответствии с описанием, приведенным в Robinson et al., J Med Chem. 1996, 39 (1), 10-18. Свободные аминогруппы также могут быть использованы для получения производных амидов, сульфонамидов и фосфонамидов. Все перечисленные фрагменты пролекарств могут иметь в своей структуре дополнительные функциональные группы, такие как простые эфирные группы, аминогруппы и карбоксильные группы.

Настоящее изобретение также относится к фармацевтически активным метаболитам соединений формулы (I), которые также могут быть использованы в способах настоящего изобретения. Используемый в настоящей заявке термин «фармацевтически активный метаболит» означает фармакологически активный продукт метаболизма в организме соединения формулы (I) или его соли. Пролекарства и активные метаболиты соединения могут быть определены с помощью обычных способов, известных и доступных специалистам в данной области. См., например, работы Bertolini, et al., J Med Chem. 1997, 40, 2011-2016; Shan, et al., J Pharm Sci. 1997, 86 (7), 765-767; Bagshawe, Drug Dev Res. 1995, 34, 220-230; Bodor, Adv Drug Res. 1984, 13, 224-331; Bundgaard, Design of Prodrugs (Elsevier Press, 1985); и Larsen, Design and Application of Prodrugs, Drug Design and Development (Krogsgaard-Larsen, et al., eds., Harwood Academic Publishers, 1991).

Соединения формулы (I) и их фармацевтически приемлемые соли, фармацевтически приемлемые пролекарства и фармацевтически активные метаболиты настоящего изобретения могут найти применение в качестве модуляторов PHD в способах настоящего изобретения. Понятие «модуляторы» включает как ингибиторы, так и активаторы, где «ингибиторы» означает соединения, которые понижают, предотвращают, дезактивируют, десенсибилизируют или регулируют экспрессию или активность PHD на понижение, а «активаторы» относится к соединениям, которые повышают, активируют, способствуют, сенсибилизируют или регулируют экспрессию или активность PHD на повышение.

Используемые в настоящей заявке термины «лечить» или «лечение» относятся к введению активного агента или соединения настоящего изобретения пациенту с целью терапевтического или профилактического благоприятного влияния посредством модуляции активности пролилгидроксилазы. Лечение включает обращение течения, улучшение, облегчение, замедление прогрессирования, уменьшение чувствительности или предотвращение заболевания, расстройства или состояния, или одного или более симптомов такого заболевания, расстройства или состояния, опосредованного модуляцией активности PHD. Используемый в настоящей заявке термин «пациент» относится к млекопитающему пациенту, нуждающемуся в таком лечении, например к человеку.

Соответственно, настоящее изобретение относится к способам использования описанных в настоящей заявке соединений для лечения тех пациентов, у которых диагностировано опосредуемое пролилгидроксилазой заболевание, расстройство или состояние, такие как анемия, сосудистые расстройства, нарушения обмена веществ и заживление раны. Симптомы патологических состояний подразумеваются включенными в объем понятия «медицинские состояния, расстройства или болезни».

Используемые в настоящей заявке термины «гипоксия» или «гипоксическое расстройство» относятся к состоянию, при котором существует недостаточный уровень кислорода в крови или недостаточный уровень снабжения тканей или органов кислородом. В основе гипоксических расстройств могут лежать различные механизмы, включая недостаточную способность крови к переносу кислорода (т.е. анемия), недостаточный ток крови к ткани и (или) органу, причиной которого является либо сердечная недостаточность, либо блокада кровеносных сосудов и (или) артерий (т.е. ишемия), пониженное барометрическое давление (т.е. «горная болезнь» на больших высотах), или случаи, когда неправильно функционирующие клетки не способны использовать кислород должным образом (т.е. гистотоксические состояния). Соответственно, специалист в данной области определит, что настоящее изобретение может найти применение при лечении различных гипоксических состояний, включая анемию, сердечную недостаточность, ишемическую болезнь сердца, тромбоэмболию, инсульт, ангину и тому подобное.

В предпочтительном варианте осуществления молекулы, составляющие предмет настоящего изобретения, могут найти применение для лечения или профилактики анемии, включая лечение анемических состояний, связанных с такими заболеваниями, как хроническое заболевание почек, поликистозное заболевание почек, гипопластическая анемия, аутоиммунная анемия, анемия трансплантации костного мозга, гранулематозный аллергический ангиит, врождённая гипопластическая анемия, синдром Фанкони, синдром Фелти, реакция «трансплантат против хозяина», трансплантация кроветворных стволовых клеток, гемолитический уремический синдром, миелодиспластический синдром, ночная пароксизмальная гемоглобинурия, остеомиелофиброз, панцитопения, истинная эритроцитарная аплазия, болезнь Шенлейна-Геноха, рефрактерная анемия с избытком бластов, ревматоидный артрит, синдром Швачмана, серповидно-клеточная анемия, большая талассемия, малая талассемия, тромбоцитопенический акроангиотромбоз, анемичные или неанемичные пациенты, проходящие хирургическое лечение, анемия, связанная с или являющаяся последствием травмы, сидеробластная анемия, анемия, являющаяся следствием иного лечения, в том числе с использованием ингибиторов ревертазы для лечения ВИЧ или кортикостероидных гормонов, циклической химиотерапии цисплатин-содержащими или цисплатин-несодержащими препаратами, алкалоидов барвинка, ингибиторов митоза, ингибиторов топоизомеразы II, антрациклинов, алкилирующих агентов, в частности, анемия, являющаяся следствием воспаления, старения и (или) хронических заболеваний. Ингибирование PHD также может также найти применение для лечения симптомов анемии, включая хроническое утомление, бледность и головокружение.

В другом предпочтительном варианте осуществления молекулы, составляющие предмет настоящего изобретения, могут найти применение для лечения или профилактики заболеваний нарушения обмена веществ, включая, помимо прочего, диабет и ожирение. В другом предпочтительном варианте осуществления молекулы, составляющие предмет настоящего изобретения, могут найти применение для лечения или профилактики сосудистых расстройств. Последние включают, помимо прочего, заболевания, связанные с гипоксией или заживлением раны, для которых требуются проангиогенные посредники для образования и развития сосудов, развития кровеносных сосудов и артериогенеза.

В способах лечения, составляющих предмет настоящего изобретения, эффективное количество фармацевтического агента в соответствии с настоящим изобретением вводится пациенту с имеющимся или диагностированным заболеванием, расстройством или состоянием. Используемый в настоящей заявке термин «эффективное количество» означает количество или дозировку, достаточную для достижения в общем желательного терапевтического или профилактического эффекта для пациента, нуждающегося в таком лечении при указанном заболевании, расстройстве или состоянии. Эффективные количества или дозы соединений настоящего изобретения могут быть оценены обычными способами, такими как моделирование, исследования с увеличением дозы или клинические исследования, а также с учетом обычных факторов, таких как режим или способ применения или доставки лекарства, фармакокинетика соединения, тяжесть и течение заболевания, расстройства или состояния, предыдущее или текущее лечение пациента, состояние здоровья и ответная реакция организма пациента на лекарство, а также оценка лечащего терапевта. Пример дозы находится в диапазоне от приблизительно 0,001 до приблизительно 200 мг соединения на 1 кг массы тела пациента в сутки, предпочтительно от приблизительно 0,05 до 100 мг/кг/сут, или от приблизительно 1 до 35 мг/кг/сут, единичной или дробной дозы (например, два раза в день, три раза в день, четыре раза в день). Для человека с массой тела 70 кг типичный диапазон допустимой дозировки составляет от приблизительно 0,05 до приблизительно 7 г/сут, или от приблизительно 0,2 до приблизительно 2,5 г/сут.

После улучшения состояния пациента, облегчения симптомов заболевания или расстройства дозировка может быть скорректирована для профилактического или поддерживающего лечения. Например, дозировка, частота введения или и то, и другое могут быть снижены в зависимости от симптомов до уровня, при котором поддерживается желательный терапевтический или профилактический эффект от приема препарата. Разумеется, если симптомы облегчены до приемлемого уровня, лечение можно прекратить. Однако при наличии рецидивов симптомов пациенту может потребоваться долговременное периодическое лечение.

Кроме того, агенты настоящего изобретения могут быть использованы в сочетании с дополнительными активными компонентами для лечения вышеупомянутых состояний. Подобные дополнительные соединения могут вводиться отдельно от агента формулы (I) или быть объединены с таким агентом в качестве дополнительного активного компонента в фармацевтической композиции настоящего изобретения. В примере варианта осуществления дополнительными активными компонентами являются соединения, о которых известно, что они эффективны для лечения состояний, расстройств или заболеваний, опосредованных ферментом PHD, или соединения, которые активны против других мишеней, связанных с конкретным состоянием, расстройством или заболеванием, такие как альтернативный модулятор PHD. Такое сочетание может использоваться для повышения эффективности (например, путем включения в сочетание соединения, повышающего действенность или эффективность соединения в соответствии с настоящим изобретением), уменьшения одного или нескольких побочных эффектов или снижения требуемой дозы соединения, составляющего предмет настоящего изобретения.

Соединения настоящего изобретения могут использоваться сами по себе или в сочетании с одним или более иными активными компонентами для приготовления фармацевтических композиций настоящего изобретения. Фармацевтическая композиция настоящего изобретения состоит из: (а) эффективного количества соединения формулы (I) или его фармацевтически приемлемой соли, фармацевтически приемлемого пролекарства или фармацевтически активного метаболита; и (b) фармацевтически приемлемого наполнителя.

Используемый в настоящей заявке термин «фармацевтически приемлемый наполнитель» относится к веществу, которое является нетоксичным, биологически переносимым и иным образом биологически приемлемым для введения пациенту, такому как инертное вещество, добавленное к фармакологической композиции или иным образом использованное как транспорт, носитель или разбавитель для повышения эффективности соединения настоящего изобретения и совместимое с этим соединением. Примеры наполнителей включают карбонат кальция, фосфат кальция, различные сахара и типы крахмалов, производные целлюлозы, желатин, растительные масла и полиэтиленгликоли.

Формы доставки фармацевтических композиций, содержащих одну или более единиц дозирования соединения настоящего изобретения, могут быть приготовлены с использованием соответствующих фармацевтических наполнителей и способов составления, сейчас или в будущем известных или доступных специалисту в данной области. В способах настоящего изобретения композиции могут вводиться местно, окулярно, орально, парентерально, ректально и путем ингаляции. Композиция может находиться в форме таблеток, капсул, саше, драже, порошков, гранул, пастилок, порошков для восстановления, жидких препаратов или суппозиториев. Предпочтительно композиция будет приготовлена для внутривенного вливания, местного применения или перорального введения. Предпочтительным способом использования изобретения является местное применение ингибиторов PHD, в частности, в тех местах, где ткань стала ишемической или была приведена в ишемическое состояние. Это может быть достигнуто с помощью специального катетера, баллона для ангиопластики или баллона для введения стента.

Для перорального введения соединения настоящего изобретения могут быть приготовлены в форме таблеток или капсул, либо в виде раствора, эмульсии или суспензии. Для приготовления композиций для перорального введения соединения могут быть сформулированы так, чтобы давать определенную дозу, например, от приблизительно 0,05 до приблизительно 100 мг/кг в сутки, или от приблизительно 0,05 до приблизительно 35 мг/кг в сутки, или от приблизительно 0,1 до приблизительно 10 мг/кг в сутки.

Таблетки для перорального введения могут включать соединение в соответствии с настоящим изобретением, смешанное с фармацевтически приемлемыми наполнителями, такими как инертные разбавители, вещества для улучшения распадаемости таблеток, связывающие агенты, смазывающие вещества, подсластители, вкусовые добавки, красители и консерванты. Соответствующие инертные наполнители включают карбонаты натрия и кальция, фосфаты натрия и кальция, лактозу, крахмал, сахар, глюкозу, метилцеллюлозу, стеарат магния, маннитол, сорбитол и т.п. Примеры жидких наполнителей для перорального введения включают этанол, глицерин, воду и т.п. Крахмал, поливинилпирролидон (PVP), натрия гликолят крахмала, микрокристаллическая целлюлоза и альгиновая кислота являются допустимыми веществами для улучшения распадаемости таблеток. Связывающие агенты могут включать крахмал и желатин. Смазывающим агентом, при его наличии, может быть стеарат магния, стеариновая кислота или тальк. При необходимости таблетки могут быть покрыты таким материалом, как глицерилмоностеарат или глицерилдистеарат, для замедления всасывания в желудочно-кишечном тракте, или могут иметь энтеросолюбельную оболочку.

Капсулы для перорального применения включают твердые и мягкие желатиновые капсулы. Для приготовления твердых желатиновых капсул соединения настоящего изобретения могут быть смешаны с твердым, полужидким или жидким разбавителем. Мягкие желатиновые капсулы могут быть приготовлены путем смешивания соединения настоящего изобретения с водой или маслом, таким как арахисовое масло или оливковое масло, с жидким парафином, смесью моно- и диглицеридов жирных кислот с короткой цепью, полиэтиленгликолем 400 или пропиленгликолем.

Жидкости для перорального применения могут быть приготовлены в форме суспензий, растворов, эмульсий или сиропов, или могут быть представлены в виде сухого продукта для восстановления водой или иным допустимым носителем перед применением. В состав подобных жидких композиций могут входить следующие компоненты: фармацевтически приемлемые наполнители, такие как суспендирующие агенты (например, сорбитол, метилцеллюлоза, альгинат натрия, желатин, гидроксиэтилцеллюлоза, карбоксиметилцеллюлоза, гелеобразный стеарат алюминия и т.д.); неводные носители, например, масла (например, миндальное масло или фракционированное кокосовое масло), пропиленгликоль, этиловый спирт или вода; консерванты (например, метил- или пропил-п-гидроксибензоат или сорбиновая кислота); смачивающие агенты, такие как лецитин; а также, при необходимости, ароматизаторы или красители.

Активные агенты, составляющие предмет настоящего изобретения, могут также вводиться пациенту непероральными путями. Например, соединения могут быть сформулированы для ректального применения в виде суппозиториев. Для парентерального введения, включая внутривенное, внутримышечное, внутрибрюшинное или подкожное, соединения настоящего изобретения могут быть представлены в виде стерильных водных растворов или суспензий, буферизованных до соответствующих величин рН и изотоничности, или в парентерально приемлемом масле. Соответствующие жидкие носители включают раствор Рингера и изотонический раствор хлорида натрия. Такие формы могут быть приготовлены в форме стандартной однократной дозировки, такой как ампулы или одноразовые приспособления для инъекций, в форме дозировки на несколько доз, таких как флаконы, из которых может быть отобрана соответствующая доза, или в твердой форме или в форме концентрата, который может быть использован для приготовления составов для введения. Типичные дозировки для внутривенного вливания могут находиться в диапазоне от приблизительно 1 до 1000 мкг/кг/мин соединения в смеси с фармакологическим носителем в течение промежутка времени от нескольких минут до нескольких суток.

Для местного применения соединения могут быть смешаны с фармацевтическим носителем в концентрации от приблизительно 0,1% до приблизительно 10% лекарства в носителе. Примеры включают лосьоны, кремы, мази и т.п. и могут быть изготовлены известными способами. В другом способе введения соединения настоящего изобретения могут использоваться в виде пластыря для трансдермальной доставки активного соединения.

Соединения настоящего изобретения могут альтернативно вводиться в способах настоящего изобретения путем ингаляции, через нос или рот, например, в виде спрея, содержащего также допустимый носитель.

В настоящей заявке используются следующие аббревиатуры и сокращения:

ТерминСокращение
Диизопропилэтиламин DIEA
Тетрагидрофуран THF
Дихлорметан DCM
Диметилсульфоксид DMSO
Диметилацетамид DMA
2-(Триметилсилил)этоксиметилхлорид SEM-Cl

2-Метоксиэтоксиметилхлорид MEMCl
мета-Хлорпероксибензойная кислотаmCPBA
N,N-ДиметилформамидDMF
ЭтанолEtOH
АцетонитрилACN
ЭтилацетатEtOAc
N-(3-Диметиламинопропил)-N-этилкарбодиимид EDCI
N,Nхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 -ДиизопропилкарбодиимидDIC
N-(3-Диметиламинопропил)-N'-этилкарбодиимид EDAC
Гексафторфосфат O-(7-азабензотриазол-1-ил)-N,N,N',N'-тетраметилурония HATU
1,8-Диазобицикло[5.4.0]ундец-7-ен DBU
Дихлорэтан DCE

Ниже описаны примеры соединений, которые могут применяться в способах настоящего изобретения, путем ссылок на иллюстративные схемы синтеза для их общего получения и последующие конкретные примеры. Специалисты определят, что для получения различных раскрытых в настоящей заявке соединений исходные реагенты могут быть выбраны соответствующим образом так, чтобы требуемые заместители сохранялись при проведении всей схемы реакции при наличии или в отсутствие защиты, в зависимости от ситуации, и давали требуемый продукт. В качестве альтернативы может быть необходимо или желательно ввести вместо требуемого заместителя соответствующую группу, которая может быть проведена через схему реакции и затем заменена соответствующим образом на требуемый заместитель. Если не указано иное, все химические переменные соответствуют определениям выше при описании формулы (I). Реакции могут проводиться в диапазоне температур от температуры плавления до температуры кипения растворителя и предпочтительно от 0°C до температуры кипения растворителя. Реакции также могут проводиться в герметично закрытом реакторе при температуре нормальной температуры кипения растворителя.

Схема A

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Согласно схеме А, соединения формулы (I) получают из производных антраниловой кислоты (III), где G 2 представляет собой -OH, -NH2 или -OC1-4 алкил, и R1 представляет собой заместитель, независимо выбранный из группы, состоящей из H, галогена, C1-4 алкила, CF3, трифторC1-4алкокси, -OC 1-4алкила и -NO2. Различные производные антраниловой кислоты общей формулы (III), коммерчески доступные или полученные в соответствии с известными способами соединения, при нагревании вводят в реакцию с мочевиной с получением хиназолин-2,4-дионов формулы (IV). Хлорированием соединений формулы (IV) с помощью известных способов или способов, описанных в работе Bioorganic & Medicinal Chemistry, 2003, 11, 2439-2444, с использованием оксихлорида фосфора (POCl3) в растворителе, таком как ацетонитрил (могут также использоваться вспомогательные основные добавки, такие как третичные амины, например, алкилзамещенные анилины или диизопропилэтиламин (DIEA)) при нагревании получают дихлорхиназолины формулы (V). Гидролиз соединений формулы (V) с помощью известных способов или способов, описанных в работе Journal of Medicinal Chemistry, 2007, 50, 2297-2300, с использованием соответствующего основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KOH и т.п., в растворителе, таком как THF, дает хлорхиназолиноны формулы (VI). Для защиты хлорхиназолинонов формулы (VI) используют соответствующие защитные реагенты, такие как 2-метоксиэтоксиметил хлорид (MEM-Cl), в присутствии основания, такого как DIEA, в растворителе, таком как THF, получая (VII a) или (VIIb) или их смесь. Замещение хлора во 2 положении в соединениях формулы (VIIa или VII b) с помощью различных коммерчески доступных пиразол-4-карбоксилатов формулы (IX) осуществляют в полярном апротонном растворителе, таком как ДМФ, N,N-диметилацетамид (ДМА) или ТГФ или их смеси, в присутствии соответствующего основания, такого как Cs2 CO3, K2CO3, Na2CO 3, NaH или их смеси, при повышенной температуре, обычно в диапазоне от 80°C до 120°C. Последующее снятие защитной группы с использованием кислоты, такой как HCl, в соответствующем растворителе, таком как этанол, дает соединения формулы (VIII). Щелочной гидролиз соединений формулы (VIII) подходящим основанием, таким как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, дает соединения формулы (I).

Альтернативно, соединения формулы (VI) непосредственно вводят в реакцию с различными коммерчески доступными пиразол-4-карбоксилатами формулы (IX), в растворителе, таком как ксилол, при повышенных температурах, обычно в диапазоне от 100°C до 130°С, с получением соединения формулы (VIII), исключая, таким образом, необходимость использования защитной группы. Последующий щелочной гидролиз соединений формулы (VIII) соответствующим основанием, таким как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, дает соединения формулы (I).

Схема B

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Соединения формулы (I) также получают по схеме B из соответствующим образом замещенных коммерчески доступных или синтезируемых анилинов формулы (X), (XV), (XVII), (XXVII) или (XXX), которые получают с использованием известных способов или способов, описанных в схеме C, или способов, описанных в работе Journal of Organic Chemistry, 2008, 73 (6), 2473-75. Согласно схеме B, функционализированные анилины формулы (X), (XV), (XVII), (XXVII) или (XXX) конденсируют с изотиоцианатами, такими как этоксикарбонилизотиоцианат, в растворителе, таком как дихлорметан (DCM), при температурах от комнатной до температуры кипения растворителя, получая соединения формулы (XXIV). Последующее сочетание соединений формулы (XXIV) с коммерчески доступными замещенными пиразол-4-карбоксилатами формулы (IX), в присутствии агентов реакции сочетания, таких как EDCI, DIC и т.п., в присутствии или в отсутствие азотного основания, такого как триэтиламин, дает соединения формулы (XI). Циклизация соединений формулы (XI) в присутствии соответствующей кислоты Льюиса, такой как триметилхлорсилан, хлорид титана (IV) и т.п., добавок, таких как 2,6-ди-трет-бутилпиридин, которые могут использоваться или не использоваться, в растворителе, таком как DCE или DMF, толуол и т.п., при температурах от комнатной до температуры кипения растворителя, дает соединения формулы (VIII). Щелочной гидролиз соединений формулы (VIII) соответствующим основанием, таким как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, дает соединения формулы (I). В приведенных схемах могут быть использованы множество известных и коммерчески доступных анилинов. Приведенные здесь схемы также служат основой для синтеза различных промежуточных продуктов, которые не всегда коммерчески доступны и которые могут использоваться для получения соединений, составляющих предмет настоящего изобретения.

Схема C

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Промежуточные тиоэфиры формулы (XV) получают по схеме С, где HAL представляет собой Cl, I, или F. Коммерчески доступные соответствующим образом замещенные галоген-нитробензолы формулы (XIII) вводят в реакцию с замещенными алкилтиолами или тиофенолами формулы (XXVIIIa) в присутствии основания, такого как DBU, в растворителе, таком как DMF и т.п., при температурах от комнатной до температуры кипения растворителя, получая промежуточные нитро производные формулы (XIV). Восстановление нитрогруппы с помощью известных специалистам способов, например, цинковой пылью в присутствии насыщенного водного раствора NH4Cl, в растворителе, таком как ацетон и т.п., дает промежуточные анилины формулы (XV).

По схеме С также получают промежуточные простые эфиры формулы (XVII), где HAL представляет собой F или Cl. Коммерчески доступные соответствующим образом замещенные галоген-нитробензолы формулы (XIII) вводят в реакцию с фенолами (XXVIIIb) в присутствии основания, такого как карбонат калия, в растворителе, таком как DMSO, DMF, DMA, и т.п., при температуре от комнатной до температуры кипения растворителя, получая промежуточные нитро соединения формулы (XVI). Восстановление нитрогруппы с помощью известных специалистам способов, например, цинковой пылью в присутствии насыщенного водного раствора NH4Cl в растворителе, таком как ацетон и т.п., дает промежуточные анилины формулы (XVII).

По схеме С также получают промежуточные аминосоединения формулы (XXVII). Коммерчески доступные соответствующим образом замещенные галоген-нитробензолы формулы (XIII), где HAL=Cl, вводят в реакцию с доступными коммерчески или синтезированными замещенными гетероциклоалкиламинами формулы (XXVIIIc) в присутствии основания, такого как карбонат калия, в растворителе, таком как DMSO, DMF, DMA и т.п., при температуре от комнатной до температуры кипения растворителя, получая промежуточные нитро соединения формулы (XXVI). Восстановление нитрогруппы с помощью известных специалистам способов, например, цинковой пылью в присутствии насыщенного водного раствора NH4Cl в растворителе, таком как ацетон и т.п., дает промежуточные анилины формулы (XXVII).

По схеме С также синтезируют промежуточные диарилы формулы (XXX). Соединения формулы (XIII), где HAL представляет собой соответствующий галоген, в условиях реакции Судзуки вводят в реакцию с моноциклическими ароматическими или гетероароматическими борными кислотами или сложными эфирами формулы (XXVIIId), в присутствии металлоорганического катализатора на основе переходного металла, такого как PdCl2(dppf) и соответствующего основания, такого как CsF, в растворителе, таком как THF, получая промежуточные диарилы формулы (XXIX). Восстановление нитрогруппы с помощью известных специалистам способов, например, цинковой пылью в присутствии насыщенного водного раствора NH4Cl в растворителе, таком как ацетон и т.п., дает промежуточные анилины формулы (XXX).

Схема D

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Промежуточные соединения формулы (XIX) могут быть получены по схеме D. Взаимодействие замещенных производных 2-амино-4-галоген-бензойной кислоты формулы (IIIa), где G 1 представляет собой -NH2 и HAL=Cl или F, с ароматическими, гетероароматическими, бензил- и алкилтиолами или спиртами формулы (XVIII) в присутствии основания, такого как K2CO3, NaH и т.п., в растворителе, таком как DMF, позволяет получить промежуточные тиоэфиры или эфиры формулы (XIX). Когда промежуточные соединения формулы (XIX) представляют собой тиоэфиры, окисление атома серы с использованием оксона, mCPBA или других органических пероксидов позволяет получить промежуточные сульфоны и сульфоксиды формулы (XX). Также полезным может оказаться проведение окисления на других стадиях синтеза. Рацемические сульфоксиды могут быть разделены на данной или на последующей стадии с использованием известных специалистам способов, таких как хиральная хроматография или кристаллизация и т.п. По схеме D также могут быть получены промежуточные соединения формулы (XXII). Замещенные производные 2-амино-4-галоген-бензойной кислоты формулы (III), где G1 представляет собой -NH2 и HAL представляет собой Cl, Br, или F, вводят в реакцию с NHR rFg формулы (XXI), где NHRrF g представляет собой ароматический, гетероароматический, бензил-, алкил- или циклоалкиламин, в присутствии основания, такого как K2CO3 и т.п., в растворителе, таком как DMF или THF, получая промежуточные аминосоединения формулы (XXII).

Схема E

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Соединения формулы (I), в которых Ar1 представляет собой необязательно замещенный фенил или моноциклическое гетероароматическое кольцо, получают по схеме Е. Соединения формулы (VIII), в которых Y представляет собой соответствующий галоген или трифлат, в условиях реакции Судзуки вводят в реакцию с моноциклическими ароматическими или гетероароматическими борными кислотами или сложными эфирами, в присутствии металлоорганического катализатора на основе переходного металла, такого как PdCl 2(dppf), и соответствующего основания, такого как CsF, получая промежуточные диарилы формулы (XXIII). Помимо условий Судзуки, могут быть использованы другие известные в данной области реакции сочетания, например реакция с участием цинкорганических, оловоорганических, магнийорганических реагентов и другие. Щелочной гидролиз карбоксильной группы пиразольного цикла в соединениях формулы (XXIII) с помощью соответствующего основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, при температурах от комнатной температуры до температуры кипения растворителя, дает соединения формулы (I).

Кроме того, хиназолиноны формулы (VIII) перед реакцией сочетания могут быть защищены соответствующей защитной группой, например, при помощи 2-(триметилсилил)этоксиметилхлорида (SEMCl) или 2-метоксиэтоксиметил хлорида (MEM-Cl) в присутствии основания, такого как DIEA и т.п., в растворителе, таком как THF и т.п., с получением соединения формулы (XXXX). Защитная группа защищает атом кислорода или азота хиназолинона или смеси O- и N-защищенных соединений, как указано выше пунктирными линиями. Снятие защитной группы после проведения реакции сочетания (как описано выше) осуществляют с помощью кислоты, такой как HCl, в соответствующем растворителе, таком как этанол, с получением соединения формулы (XXIII). Щелочной гидролиз карбоксильной группы пиразольного цикла в соединениях формулы (XXIII) с помощью соответствующего основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, при температурах от комнатной температуры до температуры кипения растворителя, дает соединения формулы (I).

Схема F

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Соединения формулы (I) могут быть получены по схеме F. Соединения формулы (XXXI) окисляют с использованием известных реагентов, таких как мета-хлорнадбензойная кислота или комплекс мочевина/перекись водорода и т.п., в соответствующем растворителе, таком как DCE и т.п., с образованием соединения формулы (XXXII). Получаются сульфоксиды и сульфоны формулы (XXXII), где m=1 или 2, в зависимости от стехиометрии, используемого окислительного агента и (или) реакционной способности субстрата. В случае сульфоксидных производных, образующиеся в результате энантиомеры могут быть разделены с использованием известных специалистам способов, таких, как хиральная хроматография или классическое разделение. Щелочной гидролиз карбоксильной группы пиразольного циклас помощью соответствующего основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, при температурах от комнатной температуры до температуры кипения растворителя, дает соединения формулы (I).

Схема G

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Соединения формулы (XXXIV) получают по схеме G. Хиназолиноны формулы (VIII) защищают соответствующей защитной группой с использованием 2-(триметилсилил)этоксиметил хлорида (SEM-Cl) или 2-метоксиэтоксиметил хлорида (MEM-Cl) в присутствии основания, такого как DIEA и т.п., в растворителе, таком как ТГФ и т.п., получая соединения формулы (XXXIII). Защитная группа защищает атом кислорода или азота хиназолинона или смеси O- и N-защищенных соединений, как указано выше пунктирными линиями. Восстановление нитрогруппы соединений формулы (XXXIII) с помощью известных специалисту способов, например, цинковой пылью в присутствии насыщенного водного раствора NH4Cl, в растворителе, таком как ацетон и т.п., дает промежуточные анилины формулы (XXXIV).

Схема H

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Соединения формулы (XXXVI) получают по схеме G. Восстановительным аминированием хиназолинонов формулы (XXXIV), с помощью известных специалисту способов, например, реакции соединений формулы (XXXIV) с соответствующим альдегидом формулы (XXXVa) в присутствии восстановителя, такого как NaBH(OAc) 3, NaBH4, или NaCNBH3 в растворителе, таком как 1,2-дихлорэтан (DCE) и т.п., с возможными добавками, такими как уксусная кислота или соответствующая кислота Льюиса, получают хиназолиноны формулы (XXXVI). Последующее снятие защитной группы с помощью кислоты, такой как HCl, в соответствующем растворителе, таком как этанол, с последующим щелочным гидролизом с использованием соответствующего основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, дает соединения формулы (I).

Соединения формул (XXXVII), (XXXVIII) и (XXXIX) получают по схеме G. Хиназолиноны общей формулы (XXXIV) вводят в реакцию сочетания с коммерчески доступными или синтезированными сульфонилхлоридами формулы (XXXVb), хлорангидридами кислот формулы ( XXXVc), или изоцианатами формулы (XXXVd), в присутствии основания, такого как DIEA, пиридин и т.п., в растворителе, таком как THF и т.п., при температурах от 0°C до 60°С, с образованием соединений формулы (XXXVII), (XXXVIII) и (XXXIX). Последующее снятие защитной группы с помощью кислоты, такой как HCl, в соответствующем растворителе, таком как этанол, с последующим щелочным гидролизом с использованием соответствующего основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KОН или их смеси в растворителе, таком как THF дает сульфаниламиды формулы (I), амиды формулы (I) и мочевины формулы (I).

ПРИМЕРЫ

Химия

Если не указано иное, для получения описанных в приведенных ниже примерах соединений и соответствующих аналитических данных использовали следующие экспериментальные и аналитические процедуры.

Если не указано иное, реакционные смеси перемешивали на магнитной мешалке при комнатной температуре (кт). Если растворы были «осушены», то, как правило, для этого использовали осушающий агент, такой как Na2SO4 или MgSO4. Если смеси, растворы и экстракты были «концентрированы», то обычно их концентрировали на роторном испарителе при пониженном давлении.

Тонкослойную хроматографию (ТСХ) проводили на пластинах с нанесенным силикагелевым покрытием Merck 60 F254 2,5 см x 7,5 см 250 мкм или 5,0 см x 10,0 см 250 мкм. Препаративную тонкослойную хроматографию проводили на пластинах с нанесенным силикагелевым покрытием EM Science 60 F254 20 см x 20 см 0,5 мм с концентрирующей зоной 20 см x 4 см.

Если не указано иное, нормально-фазовую колоночную флэш-хроматографию (КФХ) проводили на силикагеле (SiO2), используя в качестве элюента смесь гексаны/этилацетат.

Обращенно-фазовую высокоэффективную жидкостную хроматографию (ВЭЖХ) проводили на ВЭЖХ-хроматографе Hewlett Packard серии 1100 с колонкой Eclipse XDB-C8 (3,5 мкм, 4,6 x 150 мм). Детектирование вели на хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 =230, 254 и 280 нм. Используемый градиент составлял от 1 до 99% ацетонитрил/вода (+0,05% трифторуксусной кислоты) в течение 8,0 мин при скорости протока 0,75 мл/мин. Альтернативно, препаративную ВЭЖХ проводили при помощи автоматизированной ВЭЖХ-системы Shimadzu с устройством для ввода и сбора жидкости Gilson 215 и программным обеспечением LCMSsolution. УФ-детектирование пика выполняли при хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 =254 нм. Использовали колонку с обращенной фазой Inertsil ODS-3 (3 мкм, 30 X 100 мм); градиент подвижной фазы от 5 до 99% ацетонитрил/вода (+0,05% трифторуксусной кислоты) в течение 7 мин при скорости потока 80 мл/мин. Колонку подогревали до 45°C на водяной бане. Альтернативно, препаративную ВЭЖХ проводили при помощи автоматизированной ВЭЖХ-системы Dionex APS с программным обеспечением Chromeleon и УФ-детектированием пика при хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 =220 и 254 нм, оснащенной колонкой с обращенной фазой Sunfire prep C18 OBD (5 мкм, 30 X 150 мм); используемый градиент подвижной фазы составлял от 15 до 100% ацетонитрил/вода (+0,05% трифторуксусной кислоты) в течение 10-20 мин при скорости потока 20 мл/мин.

Если не указано иное, масс-спектры (МС) получали на приборе Agilent серии 1100 MSD, оснащенном многорежимным ESI/APCI-источником положительной и отрицательной ионизации

Спектры ЯМР были получены на спектрометрах Bruker, модель DRX. Ниже приведен формат представления данных 1H ЯМР: химический сдвиг в миллионных долях в сторону слабого поля от сигнала тетраметилсилана, используемого в качестве стандарта (наблюдаемая мультиплетность, константа спин-спинового взаимодействия J в Гц, интеграл).

Химические наименования генерировали с использованием программного обеспечения ChemDraw версии 6.0.2 (CambridgeSoft, г. Кембридж, штат Массачусетс, США) или ACD/Name версии 9 (Advanced Chemistry Development, г. Торонто, пров. Онтарио, Канада).

Пример 1: 1-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 7-хлор-1H-хиназолин-2,4-диона. Смесь 2-амино-4-хлорбензойной кислоты (2,00 г, 11,6 ммоль) и мочевины (2,80 г, 46,6 ммоль) выдержали при 200°C в течение 1 ч. Затем смесь охладили до комнатной температуры и полученную массу хорошо растерли с водой. Продукт отделили фильтрованием (2,30 г, 100%). Данные МС и ЯМР согласуются с ранее описанными данными: Organic Process Research & Development, 2003, 7, 700-706. 1H ЯМР (600 МГц, DMSO-d6): 12,00 (уш с, 2H); 8,59-8,53 (м, 1H); 7,93-7,80 (м, 2H).

Стадия B. Получение 2,4,7-трихлорхиназолина. Смесь 7-хлор-1H-хиназолин-2,4-диона (2,0 г, 10 ммоль) суспендировали в ацетонитриле (ACN) (50 мл) и затем добавили POCl3 (5,0 мл, 55 ммоль). После этого добавили DIEA (5,0 мл, 28 ммоль). Полученную смесь кипятили с обратным холодильником в течение 36 ч, затем охладили до комнатной температуры и сконцентрировали. Остаток осторожно обработали смесью льда с бикарбонатом натрия. Полученное твердое вещество собрали фильтрованием и высушили. Хроматографической очисткой (EtOAc/гексаны от 0:100 до 10:90) выделили искомое соединение (2,1 г, 89%). Данные МС и ЯМР согласуются с ранее описанными данными: Bioorganic & Medicinal Chemistry, 2003, 11, 2439-2444. 1H ЯМР (400 МГц, DMSO-d6): 8,32 (д, J=8,7 Гц, 1H); 8,20 (д, J=1,9 Гц, 1H); 7,93 (дд, J=9,0, 2,1 Гц, 1H).

Стадия C. Получение 2,7-дихлор-4-оксохиназолина. К охлажденной до 0°C смеси 2,4,7-трихлорхиназолина (2,0 г, 8,5 ммоль) и тетрагидрофурана (30 мл) добавили 1,0 М водный раствор гидроксида натрия (19 мл, 19 ммоль). Реакционной смеси дали подогреться до комнатной температуры и энергично перемешивали в течение 2 ч. Смесь сконцентрировали для удаления THF, оставшуюся водную фазу охладили до 0°C и подкислили путем добавления 1,0 М водного раствора HCl (25 мл). Полученную смесь выдерживали при 0°C в течение 20 мин, отделили осадок фильтрованием и высушили, получив искомое соединение (1,7 г, 92%). Данные МС и ЯМР согласуются с ранее описанными данными: Journal of Medicinal Chemistry, 2007, 50, 2297-2300.

Стадия D. Получение 2,7-дихлор-4-(2-метоксиэтоксиметокси)-хиназолина. В раствор 2,7-дихлор-4-оксохиназолина (1,7 г, 7,8 ммоль) и DIEA (2,1 мл, 12 ммоль) в THF (20 мл) по каплям добавили 2-метоксиэтоксиметилхлорид (1,0 мл, 8,8 ммоль). Реакцию вели при комнатной температуре в течение 16 ч, после чего добавили EtOAc (250 мл). Полученный раствор промыли водой (2 X 100 мл) и насыщенным солевым раствором (100 мл). Затем органическую фазу высушили и сконцентрировали, и полученный остаток растерли с EtOH, получив искомое соединение (2,0 г, 83%). Это вещество использовали непосредственно без дальнейшей очистки.

Стадия E. Получение этилового эфира 1-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Смесь 2,7-дихлор-4-(2-метоксиэтоксиметокси)-хиназолина (0,68 г, 2,2 ммоль), этилпиразол-4-карбоксилата (0,34 г, 2,4 ммоль), Cs2CO3 (1,2 г, 3,6 ммоль) и безводного DMF (10 мл) выдержали при 120°C в течение 20 мин и затем охлаждали до 0°C. Затем смесь осторожно разбавили 1 М водного раствора HCl (30 мл). Полученной смеси дали прогреться до комнатной температуры и фильтрованием собрали выпавший осадок, получив искомое соединение (0,35 г, 50%). МС (ХИ): рассчитано для C 14H11ClN4O3: 318,7; получено m/z: 317,0 [M-H]-. 1H ЯМР (400 МГц, DMSO-d6 ): 13,04 (уш с, 1H); 8,99 (с, 1H); 8,32 (с, 1H); 8,11 (д, J=8,5 Гц, 1H); 7,75 (с, 1H); 7,54 (дд, J=8,5, 2,1 Гц, 1H); 4,30 (кв, J=7,1 Гц, 2H); 1,33 (т, J=7,1 Гц, 3H).

Стадия F. Получение 1-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (240 мг, 0,74 ммоль), 1 М водного раствора LiOH (4,0 мл) и THF (6 мл) перемешивали на высокой скорости в течение 6 ч. Затем смесь сконцентрировали для удаления THF, водный остаток охладили до 0°C и подкислили до pH 2 1 М водного раствора HCl. Выпавший осадок собрали фильтрованием и получили искомое соединение (205 мг, 71%). МС (ХИ): рассчитано для C12 H7ClN4O3, 290,7; получено m/z: 289,0 [M-H]-. 1H ЯМР (400 МГц, DMSO-d 6): 12,99 (уш с, 2H); 8,93 (д, J=0,7 Гц, 1H); 8,27 (с, 1H); 8,11 (д, J=8,5 Гц, 1H); 7,74 (д, J=1,9 Гц, 1H); 7,54 (дд, J=8,5, 2,1 Гц, 1H).

Соединения в Примерах 2-16 были получены с использованием способов, аналогичных описанным в Примере 1.

Пример 2: 1-(7-трифторметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 1, с использованием на стадии А 2-амино-4-трифторметилбензойной кислоты. МС (ХИ): рассчитано для C13H7F3N4O 3: 324,2; получено m/z: 323,0 [M-H]-. 1 H ЯМР (400 МГц, DMSO-d6): 14,17-12,12 (уш м, 2H); 8,98 (д, J=0,6 Гц, 1H); 8,32 (д, J=8,3 Гц, 1H); 8,29 (с, 1H); 8,02 (с, 1H); 7,80 (д, J=8,3 Гц, 1H).

Пример 3: 1-(6,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 1, с использованием на стадии А 2-амино-4,5-дихлорбензойной кислоты. МС (ХИ): рассчитано для C12H6Cl2N4O3 : 325,1; получено m/z: 323,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d6): 13,58-12,82 (уш м, 2H); 8,92 (с, 1H); 8,28 (с, 1H); 8,21 (с, 1H); 7,96 (с, 1H).

Пример 4: 1-(6-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-5-фторбензойной кислоты. МС (ХИ): рассчитано для C 12H7FN4O3: 274,2; получено m/z: 273,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d 6): 13,53-12,42 (уш м, 2H); 8,93 (с, 1H); 8,26 (с, 1H); 7,87-7,65 (м, 3H).

Пример 5: 1-(6,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота, трифторацетатная соль.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-4,5-дифторбензойной кислоты. Искомое соединение очищали с использованием препаративной обращенно-фазовой ВЭЖХ. МС (ИЭР): рассчитано для C12H6F2N 4O3: 292,2; получено m/z: 209,9 [M-H]- . 1H ЯМР (500 МГц, DMSO-d6): 13,79-12,30 (уш м, 2H); 8,95-8,87 (уш м, 1H); 8,26 (с, 1H); 8,04 (с, 1H); 7,76 (с, 1H).

Пример 6: 1-(5-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-6-хлорбензойной кислоты. МС (ИЭР): рассчитано для C 12H7ClN4O3: 290,7; получено m/z: 289,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d 6): 13,39-12,49 (м, 2H); 8,94 (с, 1H); 8,27 (с, 1H); 7,75 (т, J=8,0 Гц, 1H); 7,63 (д, J=7,9 Гц, 1H); 7,51 (д, J=7,8 Гц, 1H).

Пример 7: 1-(8-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-3-метоксибензойной кислоты. МС (ИЭР): рассчитано для C13H10N4O4: 286,2; получено m/z: 287,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,97 (уш с, 1H); 12,85 (уш с, 1H); 8,88 (с, 1H); 8,24 (с, 1H); 7,70 (д, J=7,6 Гц, 1H); 7,46 (т, J=6,9 Гц, 1H); 7,42 (д, J=6,5 Гц, 1H); 3,95 (с, 3H).

Пример 8: 1-(6-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-5-метилбензойной кислоты. МС (ИЭР/ХИ): рассчитано для C13H10N4O3: 270,2; получено m/z: 271,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,14-12,84 (уш с, 1H); 12,82-12,56 (уш с, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 7,94 (с, 1H); 7,68 (д, J=7,9 Гц, 1H); 7,60 (д, J=7,8 Гц, 1H); 2,46 (с, 3H).

Пример 9: 1-(8-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-3-метилбензойной кислоты. МС (ИЭР): рассчитано для C13H10N4O3: 270,3; получено m/z: 269,2 [M-H]-. 1H ЯМР (500 МГц, DMSO-d6): 13,29-12,58 (уш м, 2H); 9,03 (с, 1H); 8,25 (с, 1H); 7,97 (д, J=7,9 Гц, 1H); 7,70 (д, J=7,2 Гц, 1H); 7,40 (т, J=7,6 Гц, 1H); 2,58 (с, 3H).

Пример 10: 1-(7-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-4-метилбензойной кислоты. МС (ИЭР/ХИ): рассчитано для C13H10N4O3: 270,3; получено m/z: 271,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,97 (уш с, 1H); 12,70 (уш с, 1H); 8,93 (с, 1H); 8,25 (с, 1H); 8,02 (д, J=8,0 Гц, 1H); 7,50 (с, 1H); 7,35 (д, J=7,9 Гц, 1H); 2,47 (с, 3H).

Пример 11: 1-(8-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-3-бромбензойной кислоты. МС (ХИ): рассчитано для C 12H7BrN4O3: 335,1; получено m/z: 333,0 [M-H]-. 1H ЯМР (400 МГц, DMSO-d 6): 13,31-12,94 (уш с, 2H); 8,91 (с, 1H); 8,28 (с, 1H); 8,22-8,07 (м, 2H); 7,41 (т, J=7,8 Гц, 1H).

Пример 12: 1-(6-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-5-иодбензойной кислоты. МС (ХИ): рассчитано для C 12H7IN4O3: 382,1; получено m/z: 380,9 [M-H]-. 1H ЯМР (400 МГц, DMSO-d 6): 13,00 (уш с, 2H); 8,94 (с, 1H); 8,38 (с, 1H); 8,27 (с, 1H); 8,12 (д, J=8,6 Гц, 1H); 7,49 (д, J=8,5 Гц, 1H).

Пример 13: 1-(6-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-5-бромбензойной кислоты. МС (ИЭР/ХИ): рассчитано для C12H7BrN4O3: 335,1; получено m/z: 336,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,87 (уш с, 2H); 8,94 (с, 1H); 8,27 (с, 1H); 8,04 (д, J=8,5 Гц, 1H); 7,91 (с, 1H); 7,68 (дд, J=8,5, 1,9 Гц, 1H).

Пример 14: 1-(8-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-3-хлорбензойной кислоты. МС (ХИ): рассчитано для C 12H7ClN4O3: 290,7; получено m/z: 292,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,13 (уш с, 2H); 8,92 (с, 1H); 8,29 (с, 1H); 8,09 (д, J=6,7 Гц, 1H); 8,00 (д, J=7,8 Гц, 1H); 7,49 (т, J=7,9 Гц, 1H).

Пример 15: 1-(4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-5-трифторметоксибензойной кислоты. МС (ХИ): рассчитано для C13H7F3N4O 4: 340,2; получено m/z: 341,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,00 (уш с, 2H); 8,96 (с, 1H); 8,28 (с, 1H); 7,97 (с, 1H); 7,89-7,79 (уш м, 2H).

Пример 16: 1-(4-оксо-8-трифторметил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 1, с использованием на стадии А 2-амино-3-трифторметилбензойной кислоты. МС (ХИ): рассчитано для C13H7F3N4O 3: 324,2; получено m/z: 325,0 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 13,28 (уш с, 1H); 13,15 (уш с, 1H); 8,81 (с, 1H); 8,40 (д, J=6,9 Гц, 1H); 8,32 (с, 1H); 8,22 (д, J=7,5 Гц, 1H); 7,64 (т, J=7,8 Гц, 1H).

Пример 17: 1-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[(3,4-диметоксифениламино)-этоксикарбонилиминометил]-1H-пиразол-4-карбоновой кислоты. Раствор 3,4-диметоксианилина (0,15 г, 1,0 ммоль), этилизотиоцианатформата (0,14 мл, 1,2 ммоль) в DCM (10 мл) перемешивали при комнатной температуре в течение 1 ч. Затем добавили триэтиламин (0,42 мл, 3,0 ммоль), этилпиразол-4-карбоксилат (0,17 г, 1,2 ммоль) и EDCI (0,19 г, 1,2 ммоль) и перемешивали раствор при комнатной температуре в течение 5 ч. Полученную смесь сконцентрировали, разбавили водой и экстрагировали DCM. Органическую фазу высушили и сконцентрировали, получив сырое искомое соединение (390 мг, 100%). Это вещество использовали без дальнейшей очистки. МС (ИЭР): рассчитано для C18H22N4O6: 390,4; получено m/z: 391,4 [M+H]+.

Стадия B. Получение этилового эфира 1-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[(3,4-диметоксифениламино)-этоксикарбонилиминометил]-1H-пиразол-4-карбоновой кислоты (0,39 г, 1,0 ммоль) в DMF (3 мл) добавили хлортриметилсилан (1,26 мл, 10,0 ммоль) и выдержали полученную смесь при 80°C в течение 16 ч в герметичном реакторе. Затем реакционную смесь охладили и добавили воду (2 мл). Сырую реакционную смесь сконцентрировали в вакууме и довели рН полученной водной смеси до рН 7 при помощи 2 М водного раствора NH4OH. Остаток хорошо растерли и собрали вакуумным фильтрованием. Полученное искомое соединение (0,28 г, 81%) очистили с использованием препаративной обращенно-фазовой ВЭЖХ. МС (ИЭР): рассчитано для C16H16N 4O5: 344,4; получено m/z: 345,7 [M+H]+ . 1H ЯМР (400 МГц, DMSO-d6): 13,06-12,23 (уш м, 1H); 8,97 (с, 1H); 8,28 (с, 1H); 7,47 (с, 1H); 7,21 (с, 1H); 4,29 (кв, J=7,1 Гц, 2H); 3,93 (с, 3H); 3,89 (с, 3H); 1,32 (т, J=7,1 Гц, 3H).

Стадия C. Получение 1-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,28 г, 0,81 ммоль), 1 М водного раствора KOH (3,0 мл) и THF (3,0 мл) перемешивали в течение 4 ч. Затем смесь сконцентрировали для удаления THF, а оставшуюся водную фазу подкислили до рН 2 путем добавления 1,0 М водного раствора HCl. Выпавший осадок собрали фильтрованием, получив искомое соединение (0,23 г, 89%). МС (ИЭР): рассчитано для C14H12N4 O5: 316,3; получено m/z: 317,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,32-12,29 (уш м, 2H); 8,90 (с, 1H); 8,22 (с, 1H); 7,47 (с, 1H); 7,19 (с, 1H); 3,93 (с, 3H); 3,89 (с, 3H).

Пример 18: 1-(5,6,7-триметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием на стадии А 3,4,5-триметоксианилина. МС (ИЭР): рассчитано для C15 H15N4O6: 346,3; получено m/z: 347,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,16-12,82 (уш м, 1H); 12,64-12,20 (уш м, 1H); 8,90 (с, 1H); 8,24 (с, 1H); 7,04 (с, 1H); 3,94 (с, 3H); 3,83 (с, 3H); 3,79 (с, 3H).

Пример 19: 1-(6-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием на стадии А 4-третбутиланилина. МС (ИЭР): рассчитано для C16 H16N4O3: 312,3; получено m/z: 313,2 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 12,90 (уш м, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 8,07 (д, J=2,1 Гц, 1H); 7,94 (дд, J=8,6, 2,2 Гц, 1H); 7,66 (д, J=8,4 Гц, 1H); 1,36 (с, 9H).

Пример 20: 1-(4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием на стадии А 4-феноксианилина. МС (ИЭР): рассчитано для C18H 12N4O4: 348,3; получено m/z: 349,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,16-12,96 (уш м, 2H); 8,94 (с, 1H); 8,24 (с, 1H); 7,74 (с, 1H); 7,60 (дд, J=8,9 Гц, 2,9, 1H); 7,48 (т, J=8,0 Гц, 3H); 7,25 (т, J=7,4 Гц, 1H); 7,15 (д, J=7,8 Гц, 2H).

Пример 21: 1-(6-циклогексил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием на стадии А 4-циклогексиланилина. МС (ИЭР): рассчитано для C18 H18N4O3: 338,3; получено m/z: 339,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,95 (с, 1H); 12,78 - 12,59 (уш м, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 7,95 (с, 1H); 7,74 (д, J=7,3 Гц, 1H); 7,62 (д, J=8,0 Гц, 1H); 2,68 (с, 1H); 1,82 (д, J=12,7 Гц, 4H); 1,72 (д, J=12,7 Гц, 1H); 1,44 (дд, J=24,5, 12,6 Гц, 4H); 1,29 (с, 1H).

Пример 22: 1-(7-хлор-4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием на стадии А 3-хлор,4-трифторметоксианилина. МС (ИЭР): рассчитано для C 13H6ClF3N4O4 : 374,6; получено m/z: 375,3 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,49-13,16 (уш м, 1H); 13,08 (с, 1H); 8,95 (с, 1H); 8,30 (с, 1H); 8,10 (с, 1H); 8,05 (с, 1H).

Пример 23: 1-(1-оксо-2,7-дигидро-1H-пиррол[3,2-f]хиназолин-3-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием на стадии А 5-аминоиндола. МС (ИЭР): рассчитано для C14H 9N5O3: 295,3; получено m/z: 296,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 11,79 (с, 1H); 8,97 (с, 1H); 8,24 (с, 1H); 7,93 (д, J=8,6 Гц, 1H); 7,62 (т, J=2,7 Гц, 1H); 7,45 (д, J=8,6 Гц, 1H); 7,30 (с, 1H).

Пример 24: 1-[6-(4-трет-бутилфенилсульфанил)-7-хлор-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 1-(4-трет-бутилфенилсульфанил)-2-хлор-4-нитробензола. К раствору 4-трет-бутилтиофенола (0,95 г, 5,7 ммоль) и 3,4-дихлорнитробензола (1,0 г, 5,2 ммоль) в DMF (15 мл) по каплям прибавили чистый 1,8-диазабицикло[5.4.0]ундец-7-ен (DBU, 1,2 мл, 7,8 ммоль). Раствор перемешивали в течение 1 ч при комнатной температуре, а затем в течение 1 ч при 60°C. Затем смеси дали остыть и вылили на лед. Полученный осадок желтого цвета собрали и высушили. Полученный сырой продукт использовали без дополнительной очистки.

Стадия B. Получение 4-(4-трет-бутилфенилсульфанил)-3-хлоранилина. 1-(4-трет-бутилфенилсульфанил)-2-хлор-4-нитробензол растворили в ацетоне (15 мл), затем добавили насыщенный водный раствор NH4Cl (5 мл) и охладили смесь до 0°C. Затем при быстром перемешивании в течение 10 минут небольшими порциями добавили цинковую пыль (3,7 г, 56 ммоль). Полученной смеси дали прогреться до комнатной температуры и перемешивали в течение 3 ч. Затем смесь разбавили EtOAc (250 мл), высушили и профильтровали через Celite®. После удаления растворителя получили остаток желтого цвета, который использовали без дополнительной очистки. МС (ИЭР): рассчитано для C16H18 ClNS: 291,1; получено m/z: 292,1 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 7,33-7,21 (м, 3H); 6,95 (д, J=8,5 Гц, 2H); 6,77 (д, J=2,4 Гц, 1H); 6,55 (дд, J=8,4, 2,4 Гц, 1H); 5,80 (с, 2H); 1,22 (с, 9H).

Стадия C. Получение 1-[6-(4-трет-бутилфенилсульфанил)-7-хлор-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием 4-(4-трет-бутилфенилсульфанил)-3-хлоранилина. МС (ИЭР): рассчитано для C22H19ClN 4O3S: 454,9; получено m/z: 455,1 [M+H]+ . 1H ЯМР (500 МГц, DMSO-d6): 13,01 (уш с, 2H); 8,91 (с, 1H); 8,26 (с, 1H); 7,87 (с, 1H); 7,57 (д, J=8,5 Гц, 2H); 7,54 (с, 1H); 7,50 (д, J=8,4 Гц, 2H); 1,22 (с, 9H).

Пример 25: 1-(7-хлор-4-оксо-6-фенилсульфанил-1,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 24, с использованием на стадии А тиофенола. МС (ИЭР): рассчитано для C18H11 ClN4O3S: 398,0; получено m/z: 399,0 [M+H] +. 1H ЯМР (500 МГц, DMSO-d6): 13,04 (уш с, 2H); 8,91 (с, 1H); 8,26 (с, 1H); 7,87 (с, 1H); 7,63-7,47 (м, 6H).

Пример 26: 1-[7-хлор-6-(3,4-диметоксифенилсульфанил)-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 24, с использованием на стадии А 3,4-диметокситиофенола. МС (ИЭР): рассчитано для C20H15ClN4O5S: 458,9; получено m/z: 459,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,02 (уш с, 2H); 8,90 (с, 1H); 7,83 (с, 1H); 7,40 (с, 1H); 7,26-7,12 (м, 3H); 3,86 (с, 3H); 3,77 (с, 3H).

Пример 27: 1-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 4-(2,6-диметилфенокси)-3-метилнитробензола. Раствор 2,6-диметилфенола (0,87 г, 7,1 ммоль), карбоната калия (0,98 г, 7,1 ммоль) и 2-фтор-5-нитротолуола (1,0 г, 6,4 ммоль) в DMF (20 мл) перемешивали при 100°C в течение 2 ч. Затем реакционную смесь разбавили 100 мл воды и экстрагировали 250 мл EtOAc. Органическую фазу промыли насыщенным солевым раствором, высушили над сульфатом натрия и сконцентрировали, получив сырое искомое соединение (1,5 г, 92%). Полученное вещество использовали без дальнейшей очистки. МС (ИЭР): рассчитано для C15 H15NO3: 257,3; получено m/z: 258,1 [M+H] +. 1H ЯМР (400 МГц, CDCl3): 8,16 (дд, J=2,8, 0,7 Гц, 1H); 7,92 (дд, J=9,1, 2,7 Гц, 1H); 7,18-7,07 (м, 3H); 6,33 (д, J=9,0 Гц, 1H); 2,50 (с, 3H); 2,09 (с, 6H).

Стадия B. Получение 4-(2,6-диметилфенокси)-3-метиланилина. В смесь 4-(2,6-диметилфенокси)-3-метилнитробензола (1,5 г, 5,9 ммоль), ацетона (20 мл) и насыщенного водного раствора хлорида аммония (20 мл) при температуре 0°C при перемешивании добавили цинковую пыль (3,86 г, 59,1 ммоль). Полученную смесь прогрели до комнатной температуры и перемешивали в течение 1 ч. Затем реакционную смесь разбавили 200 мл EtOAc и профильтровали через кизельгур. Органическую фазу промыли насыщенным солевым раствором, высушили над сульфатом натрия и сконцентрировали, получив сырое искомое соединение (0,79 г, 59%). Полученное вещество использовали без дальнейшей очистки. МС (ИЭР): рассчитано для C15 H17NO: 227,3; получено m/z: 227,1 [M+H]+ . 1H ЯМР (500 МГц, CDCl3): 7,07 (д, J=7,2 Гц, 2H); 7,01 (дд, J=8,3, 6,5 Гц, 1H); 6,60 (т, J=3,4 Гц, 1H); 6,31 (дд, J=8,5, 2,9 Гц, 1H); 6,06 (д, J=8,5 Гц, 1H); 3,36 (с, 2H); 2,34 (с, 3H); 2,11 (с, 6H).

Стадия C. Получение этилового эфира 1-{[4-(2,6-диметилфенокси)-3-метилфениламино]-этоксикарбонилиминометил}-1H-пиразол-4-карбоновой кислоты. Раствор 4-(2,6-диметилфенокси)-3-метиланилина (0,80 г, 3,5 ммоль), этилизотиоцианатформата (0,40 мл, 3,5 ммоль) в DCM (30 мл) перемешивали при комнатной температуре в течение 1 ч. Затем добавили этилпиразол-4-карбоксилат (0,54 г, 3,9 ммоль) и DIC (0,54 мл, 3,5 ммоль) и перемешивали раствор при комнатной температуре в течение 16 ч. Полученную смесь сконцентрировали и очистили КФХ (EtOAc/гексаны от 0:100 до 50:50), получив искомое соединение (0,97 г, 60%). МС (ИЭР): рассчитано для C25 H28N4O5: 464,5; получено m/z: 465,1 [M+H]+.

Стадия D. Получение этилового эфира 1-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-{[4-(2,6-диметилфенокси)-3-метилфениламино]-этоксикарбонилиминометил}-1H-пиразол-4-карбоновой кислоты (0,97 г, 2,1 ммоль) в DCE (10 мл) добавили хлорид титана (IV) (0,25 мл, 2,3 ммоль) и выдержали полученную смесь при 90°C в течение 16 ч. Затем реакционную смесь охладили до комнатной температуры и вылили в 50 мл EtOH. Смесь перемешали в течение 30 мин и сконцентрировали до сухого состояния. Полученное сухое вещество очистили КФХ (CH3CN/DCM, градиент от 0:100 до 20:80) и получили искомое соединение (0,28 г, 32%). МС (ИЭР): рассчитано для C23H22N4O 4: 418,4; получено m/z: 419,2 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 12,77 (с, 1H); 8,96 (с, 1H); 8,28 (с, 1H); 7,69 (с, 1H); 7,25 (д, J=7,4 Гц, 2H); 7,18 (дд, J=8,3, 6,7 Гц, 1H); 6,78 (с, 1H); 4,30 (кв, J=7,1 Гц, 2H); 2,55 (с, 3H); 2,08 (с, 6H); 1,32 (т, J=7,1 Гц, 3H).

Стадия E. Получение 1-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,25 г, 0,60 ммоль), 1 М водного раствора KOH (5,0 мл) и THF (5,0 мл) перемешивали в течение 4 ч. Затем смесь сконцентрировали для удаления THF, а оставшуюся водную фазу подкислили до рН 2 путем добавления 1 М водного раствора HCl. Выпавший осадок собрали фильтрованием, получив искомое соединение (0,22 г, 93%). МС (ИЭР): рассчитано для C21H18N4O 4: 390,1; получено m/z: 391,1 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 1H); 12,72 (с, 1H); 8,90 (д, J=13,2 Гц, 1H); 8,22 (с, 1H); 7,68 (с, 1H); 7,25 (д, J=7,4 Гц, 2H); 7,18 (дд, J=8,3, 6,7 Гц, 1H); 6,78 (с, 1H); 2,55 (с, 3H); 2,07 (д, J=8,2 Гц, 6H).

Пример 28: 1-[4-оксо-6-(3,4,5-триметоксифенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-{[4-(3,4,5-триметоксифенокси)-фениламино]-этоксикарбонилиминометил}-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии А-С, с использованием на стадии A 3,4,5-триметоксифенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C25 H28N4O8: 512,5; получено m/z: 513,2 [M+H]+.

Стадия B. Получение 1-[4-оксо-6-(3,4,5-триметоксифенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии D-E, с использованием на стадии D хлортриметилсилана вместо хлорида титана (IV). МС (ИЭР): рассчитано для C21 H18N4O7: 438,1; получено m/z: 439,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 12,99 (с, 1H); 12,89 (с, 1H); 8,94 (с, 1H); 8,24 (с, 1H); 7,73 (д, J=8,3 Гц, 1H); 7,57 (дд, J=8,8, 2,9 Гц, 1H); 7,48 (с, 1H); 6,50 (с, 2H); 3,74 (с, 6H); 3,68 (с, 3H).

Пример 29: 1-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-{этоксикарбонилимино-[4-(нафталин-1-илокси)-фениламино]-метил}-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии A-C, с использованием на стадии A 1-нафтола и 4-фторнитробензола. МС (ИЭР): рассчитано для C26 H24N4O5: 472,2; получено m/z: 473,2 [M+H]+.

Стадия B. Получение этилового эфира 1-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-{этоксикарбонилимино-[4-(нафталин-1-илокси)-фениламино]-метил}-1H-пиразол-4-карбоновой кислоты (0,74 г, 1,6 ммоль) в DCE (10 мл) добавили хлорид титана (IV) (0,86 мл, 7,8 ммоль) и выдержали полученную смесь при 90°C в течение 16 ч. Затем реакционную смесь охладили до комнатной температуры и вылили в 50 мл EtOH. Полученную смесь перемешивали в течение 30 мин и затем собрали твердый осадок вакуумным фильтрованием (0,46 г, 69%). МС (ИЭР): рассчитано для C24H18 N4O4: 426,1; получено m/z: 427,1 [M+H] +. 1H ЯМР (400 МГц, DMSO-d6): 12,87 (с, 1H); 8,99 (с, 1H); 8,29 (с, 1H); 8,05 (д, J=7,5 Гц, 1H); 8,02 (д, J=8,3 Гц, 1H); 7,86 (д, J=8,3 Гц, 1H); 7,79 (д, J=7,6 Гц, 1H); 7,70 (дд, J=8,9, 2,9 Гц, 1H); 7,64-7,60 (м, 1H); 7,60-7,53 (м, 2H); 7,39 (д, J=2,8 Гц, 1H); 7,23 (д, J=7,4 Гц, 1H); 4,30 (кв, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия C. Получение 1-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,42 г, 0,99 ммоль), 1 М водного раствора KOH (5,0 мл) и THF (5,0 мл) перемешивали в течение 4 ч. Затем смесь сконцентрировали для удаления THF, а оставшуюся водную фазу подкислили до рН 2 путем добавления 1 М водного раствора HCl. Выпавший осадок собрали фильтрованием, получив искомое соединение (0,34 г, 86%). МС (ИЭР): рассчитано для C22H14N4O 4: 398,1; получено m/z: 399,1 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 1H); 12,86 (с, 1H); 8,94 (с, 1H); 8,24 (с, 1H); 8,06 (д, J=8,1 Гц, 1H); 8,02 (д, J=8,3 Гц, 1H); 7,87 (д, J=8,2 Гц, 1H); 7,78 (д, J=8,2 Гц, 1H); 7,71 (дд, J=8,9, 2,9 Гц, 1H); 7,62 (т, J=7,5 Гц, 1H); 7,60-7,54 (м, 2H); 7,38 (с, 1H); 7,24 (д, J=7,4 Гц, 1H).

Пример 30: 1-[6-(3-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 3-хлорфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H11ClN4O4: 382,1; получено m/z: 383,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,00 (с, 1H); 12,95 (с, 1H); 8,95 (с, 1H); 8,25 (с, 1H); 7,77 (д, J=8,6 Гц, 1H); 7,63 (дд, J=8,8, 2,9 Гц, 1H); 7,55 (с, 1H); 7,48 (т, J=8,2 Гц, 1H); 7,30 (д, J=8,0 Гц, 1H); 7,24 (с, 1H); 7,11 (д, J=8,2 Гц, 1H).

Пример 31: 1-[6-(3-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 28, с использованием на стадии А 3-метоксифенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C19H14N4O5: 378,1; получено m/z: 379,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 1H); 12,89 (с, 1H); 8,94 (с, 1H); 8,25 (с, 1H); 7,74 (д, J=8,7 Гц, 1H); 7,60 (дд, J=8,9, 2,9 Гц, 1H); 7,49 (с, 1H); 7,37 (т, J=8,2 Гц, 1H); 6,83 (дд, J=8,3, 1,9 Гц, 1H); 6,73 (с, 1H); 6,69 (д, J=7,8 Гц, 1H); 3,77 (с, 3H).

Пример 32: 1-[6-(4-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 4-фторфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H11FN4O4: 366,1; получено m/z: 367,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,89 (с, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,76 (д, J=7,7 Гц, 1H); 7,59 (дд, J=8,9, 2,9 Гц, 1H); 7,43 (д, J=2,9 Гц, 1H); 7,35-7,28 (м, 2H); 7,25-7,19 (м, 2H).

Пример 33: 1-[6-(2-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2-фторфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H11FN4O4: 366,1; получено m/z: 367,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 1H); 12,91 (с, 1H); 8,94 (с, 1H); 8,25 (с, 1H); 7,76 (д, J=8,3 Гц, 1H); 7,63 (дд, J=8,9, 3,0 Гц, 1H); 7,53-7,44 (м, 1H); 7,42-7,28 (м, 4H).

Пример 34: 1-[6-(3-фтор-фенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 3-фторфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H11FN4O4: 366,1; получено m/z: 367,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,00 (с, 1H); 12,97-12,79 (м, 1H); 8,95 (с, 1H); 8,26 (с, 1H); 7,76 (с, 1H); 7,63 (дд, J=8,8, 2,9 Гц, 1H); 7,56 (с, 1H); 7,49 (дд, J=15,1, 8,2 Гц, 1H); 7,07 (дд, J=17,0, 9,2 Гц, 2H); 6,97 (д, J=8,0 Гц, 1H).

Пример 35: 1-[6-(3,5-ди-трет-бутилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 3,5-ди-трет-бутилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C26H28N4O4: 460,2; получено m/z: 461,2 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 1H); 12,93-12,74 (м, 1H); 8,94 (с, 1H); 8,25 (с, 1H); 7,73 (с, 1H); 7,55 (дд, J=8,8, 2,8 Гц, 1H); 7,48 (с, 1H); 7,28 (с, 1H); 6,96 (д, J=1,2 Гц, 2H); 1,28 (с, 18H).

Пример 36: 1-(4-оксо-6-м-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 3-метилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C19H14N4O4: 362,1; получено m/z: 363,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,96 (с, 1H); 12,84 (с, 1H); 8,94 (с, 1H); 8,24 (с, 1H); 7,74 (д, J=7,5 Гц, 1H); 7,58 (дд, J=8,9, 2,9 Гц, 1H); 7,46 (д, J=2,6 Гц, 1H); 7,35 (т, J=7,8 Гц, 1H); 7,06 (д, J=7,5 Гц, 1H); 6,97 (с, 1H); 6,93 (д, J=8,0 Гц, 1H); 2,33 (с, 3H).

Пример 37: 1-(4-оксо-6-о-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2-метилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C19H14N4O4: 362,1; получено m/z: 363,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 1H); 12,86 (с, 1H); 8,93 (с, 1H); 8,23 (с, 1H); 7,74 (д, J=9,0 Гц, 1H); 7,57 (дд, J=8,9, 3,0 Гц, 1H); 7,40 (д, J=7,4 Гц, 1H); 7,31 (т, J=7,1 Гц, 1H); 7,27 (с, 1H); 7,22 (т, J=7,0 Гц, 1H); 7,08 (д, J=7,9 Гц, 1H); 2,17 (с, 3H).

Пример 38: 1-[6-(2,6-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,6-дихлорфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H10Cl2N4O 4: 416,0; получено m/z: 417,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,94 (с, 2H); 8,93 (с, 1H); 8,23 (с, 1H); 7,75 (с, 1H); 7,72 (д, J=8,1 Гц, 2H); 7,60 (дд, J=8,9, 3,1 Гц, 1H); 7,45 (т, J=8,2 Гц, 1H); 7,17 (с, 1H).

Пример 39: 1-[6-(2,4-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,4-дихлорфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H10Cl2N4O 4: 416,0; получено m/z: 417,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,96 (с, 1H); 12,94-12,73 (м, 1H); 8,94 (с, 1H); 8,24 (с, 1H); 7,85 (д, J=2,5 Гц, 1H); 7,76 (д, J=8,2 Гц, 1H); 7,61 (дд, J=8,9, 3,0 Гц, 1H); 7,53 (дд, J=8,8, 2,5 Гц, 1H); 7,39 (с, 1H); 7,33 (д, J=8,8 Гц, 1H).

Пример 40: 1-[6-(2,5-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,5-дихлорфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H10Cl2N4O 4: 416,0; получено m/z: 417,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,95 (с, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,78 (д, J=8,6 Гц, 1H); 7,71 (д, J=8,8 Гц, 1H); 7,63 (дд, J=8,9, 3,0 Гц, 1H); 7,42 (д, J=4,1 Гц, 2H); 7,39 (д, J=2,4 Гц, 1H).

Пример 41: 1-[6-(4-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 4-метоксифенола и 4-фторнитробензола и с добавлением на стадии D 1,5 экв. 2,6-ди-трет-бутилпиридина. МС (ИЭР): рассчитано для C19H14N4O5: 378,1; получено m/z: 379,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,93 (с, 1H); 12,88-12,67 (м, 1H); 8,93 (с, 1H); 8,23 (с, 1H); 7,72 (д, J=8,1 Гц, 1H); 7,55 (дд, J=8,9, 2,9 Гц, 1H); 7,36 (д, J=2,8 Гц, 1H); 7,17-7,08 (м, 2H); 7,08-6,99 (м, 2H); 3,79 (с, 3H).

Пример 42: 1-[6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,6-диметилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C20H16N4O4: 376,1; получено m/z: 377,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,82 (с, 2H); 8,92 (с, 1H); 8,23 (с, 1H); 7,74 (д, J=8,8 Гц, 1H); 7,54 (дд, J=8,9, 3,0 Гц, 1H); 7,24 (д, J=7,4 Гц, 2H); 7,18 (дд, J=8,3, 6,6 Гц, 1H); 7,08 (с, 1H); 2,09 (с, 6H).

Пример 43: 1-[6-(нафталин-2-иолкси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2-нафтола и 4-фторнитробензола. МС (ИЭР): рассчитано для C 22H14N4O4: 398,1; получено m/z: 399,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,00 (с, 1H); 12,91 (с, 1H); 8,95 (с, 1H); 8,25 (с, 1H); 8,05 (д, J=8,9 Гц, 1H); 7,97 (д, J=7,9 Гц, 1H); 7,89 (д, J=8,0 Гц, 1H); 7,78 (д, J=8,1 Гц, 1H); 7,68 (дд, J=8,8, 2,9 Гц, 1H); 7,59 (с, 1H); 7,57-7,47 (м, 3H); 7,39 (дд, J=8,9, 2,4 Гц, 1H).

Пример 44: 1-[4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 5,6,7,8-тетрагидронафталин-1-ола и 4-фторнитробензола. МС (ИЭР): рассчитано для C22H18N4O 4: 402,1; получено m/z: 403,1 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 13,00 (с, 1H); 12,83 (с, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 7,73 (д, J=8,6 Гц, 1H); 7,55 (дд, J=8,8, 2,8 Гц, 1H); 7,29 (с, 1H); 7,20 (т, J=7,8 Гц, 1H); 7,03 (д, J=7,6 Гц, 1H); 6,87 (д, J=7,9 Гц, 1H); 2,84 - 2,76 (м, 2H); 2,59-2,52 (м, 2H); 1,76-1,66 (м, 4H).

Пример 46: 1-[6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, стадии С-Е, с использованием на стадии С 4-(4-хлорфенокси)-фениламина. МС (ИЭР): рассчитано для C18H11ClN4O4: 382,1; получено m/z: 383,2 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,00 (с, 1H); 12,93 (с, 1H); 8,95 (с, 1H); 8,25 (с, 1H); 7,76 (д, J=7,4 Гц, 1H); 7,62 (дд, J=8,8, 2,9 Гц, 1H); 7,51 (д, J=8,9 Гц, 3H); 7,18 (д, J=8,7 Гц, 2H).

Пример 47: 1-(4-оксо-6-п-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, стадии С-Е, с использованием на стадии С 4-п-толилоксифениламина. МС (ИЭР): рассчитано для C19H14N4O4: 362,1; получено m/z: 363,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 1H); 12,87 (с, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 7,73 (д, J=8,9 Гц, 1H); 7,58 (дд, J=8,8, 2,9 Гц, 1H); 7,40 (с, 1H); 7,28 (д, J=8,2 Гц, 2H); 7,06 (д, J=8,3 Гц, 2H); 2,34 (с, 3H).

Пример 48: 1-[7-хлор-6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, стадии С-Е, с использованием на стадии С 3-хлор-4-(4-хлорфенокси)-фениламина. МС (ИЭР): рассчитано для C18H10Cl2N4O 4: 416,0; получено m/z: 417,0 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 13,04 (с, 2H); 8,93 (с, 1H); 8,27 (с, 1H); 7,98 (с, 1H); 7,56 (с, 1H); 7,52 (д, J=8,9 Гц, 2H); 7,17 (д, J=8,8 Гц, 2H).

Пример 49: 1-[7-хлор-6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,6-диметилфенола и 2-хлор-1-фтор-4-нитробензола. МС (ИЭР): рассчитано для C20H15ClN4O 4: 410,1; получено m/z: 411,1 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 13,01 (с, 2H); 8,91 (с, 1H); 8,25 (с, 1H); 7,99 (с, 1H); 7,28 (д, J=7,3 Гц, 2H); 7,22 (дд, J=8,4, 6,5 Гц, 1H); 6,92 (с, 1H); 2,09 (с, 6H).

Пример 50: 1-[6-(2,6-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,6-дихлорфенола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C18H9Cl2FN4O 4: 434,0; получено m/z: 435,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,98 (с, 2H); 8,91 (с, 1H); 8,25 (с, 1H); 7,80 (д, J=11,4 Гц, 1H); 7,75 (д, J=8,2 Гц, 2H); 7,49 (т, J=8,2 Гц, 1H); 7,07 (д, J=8,9 Гц, 1H).

Пример 51: 1-[6-(2,6-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,6-диметилфенола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C20H15FN4O4: 394,1; получено m/z: 395,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,92 (с, 2H); 8,90 (с, 1H); 8,23 (с, 1H); 7,74 (д, J=11,6 Гц, 1H); 7,27 (д, J=6,7 Гц, 2H); 7,21 (дд, J=8,7, 6,0 Гц, 1H); 6,97 (д, J=9,1 Гц, 1H); 2,11 (с, 6H).

Пример 52: 1-[7-фтор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2-нафтола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C22H13FN4O4: 416,1; получено m/z: 417,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,04 (с, 2H); 8,94 (с, 1H); 8,27 (с, 1H); 8,05 (д, J=8,9 Гц, 1H); 7,97 (д, J=8,0 Гц, 1H); 7,87 (д, J=8,1 Гц, 1H); 7,78 (д, J=11,3 Гц, 1H); 7,68 (д, J=8,8 Гц, 1H); 7,55 (с, 1H); 7,54-7,52 (м, 1H); 7,50 (дд, J=10,8, 4,1 Гц, 1H); 7,44 (дд, J=8,9, 2,5 Гц, 1H).

Пример 53: 1-[7-хлор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 1-нафтола и 2-хлор-1-фтор-4-нитробензола. МС (ИЭР): рассчитано для C22H13ClN4O4: 432,1; получено m/z: 433,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,03 (с, 2H); 8,93 (с, 1H); 8,26 (с, 1H); 8,07 (д, J=8,2 Гц, 1H); 8,01 (д, J=7,7 Гц, 2H); 7,88 (д, J=8,2 Гц, 1H); 7,60 (ддд, J=24,5, 15,4, 7,5 Гц, 3H); 7,37 (с, 1H); 7,19 (д, J=7,5 Гц, 1H).

Пример 54: 1-[7-хлор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2-нафтола и 2-хлор-1-фтор-4-нитробензола. МС (ИЭР): рассчитано для C22H13ClN4O4: 432,1; получено m/z: 433,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,05 (с, 2H); 8,94 (с, 1H); 8,27 (с, 1H); 8,06 (д, J=8,9 Гц, 1H); 8,01 (с, 1H); 7,98 (д, J=8,0 Гц, 1H); 7,88 (д, J=7,9 Гц, 1H); 7,58 (с, 1H); 7,57-7,48 (м, 3H); 7,42 (дд, J=8,9, 2,4 Гц, 1H).

Пример 55: 1-[7-хлор-4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 5,6,7,8-тетрагидронафталин-1-ола и 2-хлор-1-фтор-4-нитробензола. МС (ИЭР): рассчитано для C22H17ClN 4O4: 436,1; получено m/z: 437,1 [M+H]+ . 1H ЯМР (500 МГц, DMSO-d6): 13,04 (с, 2H); 8,92 (с, 1H); 8,25 (с, 1H); 7,96 (с, 1H); 7,27 (с, 1H); 7,21 (т, J=7,8 Гц, 1H); 7,05 (д, J=7,6 Гц, 1H); 6,86 (д, J=7,9 Гц, 1H); 2,84-2,78 (м, 2H); 2,59-2,52 (м, 2H); 1,77-1,67 (м, 4H).

Пример 56: 1-[7-фтор-6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 3-фторфенола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C18H10F2N4O 4: 384,1; получено m/z: 385,1 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,08 (с, 2H); 8,94 (с, 1H); 8,28 (с, 1H); 7,76 (д, J=11,4 Гц, 1H); 7,72 (д, J=8,8 Гц, 1H); 7,53-7,44 (м, 1H); 7,14-7,05 (м, 2H); 7,00-6,95 (м, 1H).

Пример 57: 1-[7-фтор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 1-нафтола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C22H13FN4O4: 416,1; получено m/z: 417,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,05 (с, 2H); 8,93 (с, 1H); 8,26 (с, 1H); 8,08 (т, J=9,4 Гц, 2H); 7,86 (д, J=8,3 Гц, 1H); 7,80 (д, J=11,4 Гц, 1H); 7,63 (тд, J=13,7, 5,9 Гц, 2H); 7,55 (т, J=7,9 Гц, 1H); 7,48 (д, J=8,9 Гц, 1H); 7,19 (д, J=7,5 Гц, 1H).

Пример 58: 1-[7-фтор-6-(индан-5-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 5-инданола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C21H15FN4O4: 406,1; получено m/z: 407,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,04 (с, 2H); 8,92 (с, 1H); 8,26 (с, 1H); 7,71 (д, J=11,5 Гц, 1H); 7,48 (д, J=8,9 Гц, 1H); 7,30 (д, J=8,1 Гц, 1H); 7,04 (д, J=2,0 Гц, 1H); 6,93 (дд, J=8,1, 2,3 Гц, 1H); 2,88 (т, J=7,4 Гц, 4H); 2,06 (квинт, J=7,5 Гц, 2H).

Пример 59: 1-(7-метил-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А фенола и 2-фтор-5-нитротолуола. МС (ИЭР): рассчитано для C 19H14N4O4: 362,1; получено m/z: 363,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,01 (с, 1H); 12,79 (с, 1H); 8,91 (с, 1H); 8,24 (с, 1H); 7,67 (с, 1H); 7,46 (дд, J=8,6, 7,5 Гц, 2H); 7,32 (с, 1H); 7,23 (т, J=7,4 Гц, 1H); 7,10 (д, J=7,7 Гц, 2H); 2,41 (с, 3H).

Пример 60: 1-[6-(2,3-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,3-дихлорфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H10Cl2N4O 4: 416,0; получено m/z: 417,0 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 13,00 (с, 1H); 12,97-12,67 (м, 1H); 8,95 (с, 1H); 8,25 (с, 1H); 7,77 (с, 1H); 7,64 (дд, J=8,9, 2,9 Гц, 1H); 7,59 (д, J=8,1 Гц, 1H); 7,47 (т, J=8,2 Гц, 1H); 7,40 (с, 1H); 7,28 (д, J=8,0 Гц, 1H).

Пример 61: 1-[6-(2,6-диметилфенокси)-7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,6-диметилфенола и 4-фтор-3-метоксинитробензола. МС (ИЭР): рассчитано для C21H18N4O 5: 406,1; получено m/z: 407,1 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,99 (с, 1H); 12,70 (с, 1H); 8,91 (с, 1H); 8,22 (с, 1H); 7,34 (с, 1H); 7,24 (д, J=7,4 Гц, 2H); 7,17 (дд, J=8,5, 6,3 Гц, 1H); 6,79 (с, 1H); 4,07 (с, 3H); 2,07 (с, 6H).

Пример 62: 1-(7-метокси-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А фенола и 4-фтор-3-метоксинитробензола. МС (ИЭР): рассчитано для C19H14N4O5: 378,1; получено m/z: 379,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,01 (с, 1H); 12,79 (с, 1H); 8,93 (с, 1H); 8,25 (с, 1H); 7,45 (с, 1H); 7,41 (дд, J=8,6, 7,5 Гц, 2H); 7,35 (с, 1H); 7,17 (т, J=7,4 Гц, 1H); 7,03 (д, J=7,7 Гц, 2H); 3,95 (с, 3H).

Пример 63: 1-[6-(2,6-диметилфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 2,6-диметилфенола и 3,4,5-трифторнитробензола. МС (ИЭР): рассчитано для C20H14F2N4O 4: 412,1; получено m/z: 413,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,07 (с, 2H); 8,91 (д, J=0,4 Гц, 1H); 8,27 (с, 1H); 7,52 (д, J=11,6 Гц, 1H); 7,12 (д, J=7,5 Гц, 2H); 7,06 (дд, J=8,5, 6,2 Гц, 1H); 2,16 (с, 6H).

Пример 64: 1-(5,7-дифтор-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А фенола и 3,4,5-трифторнитробензола. МС (ИЭР): рассчитано для C18H10F2N4O4 : 384,1; получено m/z: 385,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,10 (с, 2H); 8,94 (с, 1H); 8,30 (с, 1H); 7,61 (д, J=10,7 Гц, 1H); 7,39 (дд, J=8,6, 7,5 Гц, 2H); 7,14 (т, J=7,4 Гц, 1H); 7,04 (д, J=8,0 Гц, 2H).

Пример 65: 1-[4-оксо-6-(пиридин-3-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, с использованием на стадии А 3-гидроксипиридина и 4-фторнитробензола. МС (ИЭР): рассчитано для C17H11N5O4: 349,1; получено m/z: 350,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,00 (с, 1H); 12,96-12,70 (м, 1H); 8,95 (с, 1H); 8,51 (с, 1H); 8,48 (д, J=3,8 Гц, 1H); 8,26 (с, 1H); 7,78 (с, 1H); 7,66 (дд, J=8,8, 2,2 Гц, 1H); 7,62 (д, J=8,4 Гц, 1H); 7,56-7,48 (м, 2H).

Пример 66: 1-(4-оксо-7-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 29, стадии С-Е, с использованием на стадии С 3-феноксианилина. МС (ИЭР): рассчитано для C 18H12N4O4: 348,1; получено m/z: 349,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 12,97 (с, 1H); 12,77 (с, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 8,14 (д, J=7,9 Гц, 1H); 7,52 (т, J=7,9 Гц, 2H); 7,31 (т, J=7,4 Гц, 1H); 7,22 (д, J=7,7 Гц, 2H); 7,17 (д, J=8,5 Гц, 1H); 6,96 (с, 1H).

Пример 67: 1-[4-оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота, трис(гидроксиметил)аминометановая соль.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение трет-бутилового эфира [4-(4-гидрокситетрагидропиран-4-ил)-фенил]-карбаминовой кислоты. THF (50 мл) в высушенной в печи одногорловой колбе объемом 500 мл охладили в ванне температурой -78°C в атмосфере N 2. Затем в течение 10 мин при помощи шприца по каплям прибавили раствор н-бутиллития в гексанах (15,4 мл, 2,5 M, 38,6 ммоль). Полученный прозрачный раствор перемешивали при -78°C в течение 30 мин. Затем в течение 10 мин при перемешивании по каплям прибавили N-трет-бутоксикарбонил-4-броманилин (5,00 г, 18,4 ммоль), растворенный в 10 мл THF, после чего перемешивание продолжали еще 30 мин при -78°C. Затем в течение 10 мин по каплям прибавили раствор тетрагидро-4H-пиран-4-она (2,02 г, 20,2 ммоль) в 5 мл THF. Через 150 мин реакционной смеси дали прогреться до комнатной температуры, насыщенным раствором NH4Cl довели объем до 200 мл и экстрагировали эфиром (3 x 100 мл). Объединенные органические фазы промыли водой (50 мл) и насыщенным солевым раствором (50 мл) и высушили над MgSO4. Фильтрованием с последующим концентрированием получили сырой продукт, который перекристаллизовали из 70 мл DCM с получением очищенного продукта в виде твердого вещества белого цвета (2,29 г, 42%). МС (ИЭР): рассчитано для C16H23NO4: 293,3; получено m/z: 276,1 [M-H2O+H]+. 1H ЯМР (500 МГц, CDCl3): 7,46-7,38 (м, 2H); 7,36 (д, J=8,6 Гц, 2H); 6,48 (с, 1H); 3,90 (м, 4H); 2,30-1,98 (м, 2H); 1,68 (д, J=12,1 Гц, 2H); 1,52 (с, 9H).

Стадия B. Получение трифторацетата 4-(тетрагидропиран-4-ил)-фениламина. трет-Бутиловый эфир 4-(4-гидрокси-тетрагидропиран-4-ил)-фенил]-карбаминовой кислоты (1,85 г, 6,31 ммоль) суспендировали в смеси 40 мл DCM и 20 мл триэтилсилана и в течение 2 мин диспергировали с помощью ультразвука. Затем добавили трифторуксусную кислоту (40 мл) и получили прозрачный раствор. Раствор выдержали при комнатной температуре в течение 16 ч и сконцентрировали в вакууме, получив искомый продукт в виде аморфного твердого вещества (2,40 г, 75%). МС (ИЭР): рассчитано для C11H14NO: 177,2; получено m/z: 178,1 [M+H]+. 1H ЯМР (400 МГц, DMSO): 10,17 (с, 3H); 7,35 (д, J=8,4 Гц, 2H); 7,24 (д, J=8,4 Гц, 2H); 4,13-3,81 (м, 2H); 3,43 (тд, J=11,2, 3,4 Гц, 2H); 2,97-2,64 (м, 1H); 1,91-1,35 (м, 3H).

Стадия C. Получение 1-[4-оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили из трифторацетата 4-(тетрагидропиран-4-ил)-фениламина с использованием методик, описанных в Примере 27, стадии C, D и E, используя EDCI вместо DIC на стадии C. МС (ИЭР): рассчитано для C17H16N4O4: 340,3; получено m/z: 341,1 [M+H]+, 379,1 [M+K]+ 1H ЯМР (400 МГц, DMSO):12,92 (с, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,96 (с, 1H); 7,77 (с, 1H); 7,67 (с, 1H); 3,98 (м, 2H); 3,47 (м, 2H); 3,29 (м, 4H); 2,96 (м, 1H).

Стадия D. Получение трис(гидроксиметил)аминометановой соли 1-[4-оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. 1-[4-Оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновую кислоту (0,158 г, 0,464 ммоль) в виде свободной кислоты суспендировали в смеси 10 мл MeOH и 10 мл THF и затем добавили раствор трис(гидроксиметил)аминометана (0,0562 г, 0,464 ммоль) в 1 мл воды. Полученный раствор перемешивали в течение 2 ч, затем сконцентрировали в вакууме и высушили в сушильном пистолете (0,1 мм рт. ст., 60°C), получив 214 мг порошка белого цвета (99%). МС (ИЭР): рассчитано для C 17H16N4O4: 340,3; получено m/z: 341,1 [M+H]+.

Пример 68: 1-(7-хлор-4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 2-хлор-4-нитробифенила. Смесь карбоната калия (1,48 г, 10,7 ммоль), фенилборной кислоты (645 мг, 5,29 ммоль), 3-хлор-4-иоднитробензола (1,00 г, 3,53 ммоль) и THF (31 мл) в течение 10 мин дегазировали азотом в герметично закрываемом реакторе. Затем к реакционной смеси добавили дихлорметановый аддукт [1,1'-бис(дифенилфосфин)ферроцен]дихлорпалладия (351 мг, 0,429 ммоль) и герметично закрыли реактор. Полученную смесь перемешивали при температуре 100°C в течение 42 ч. Затем смесь охладили до 23°C, разбавили DCM (40 мл) и профильтровали. Полученный фильтрат сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны от 3 до 50%) и получили искомое соединение (796 мг, 97%). 1H ЯМР (600 МГц, DMSO-d6 ): 8,42-8,41 (м, 1H); 8,26 (дд, J=8,5, 2,2, Гц 1H); 7,72 (д, J=8,5 Гц, 1H); 7,55-7,48 (м, 5H).

Стадия B. Получение 1-(7-хлор-4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии В-Е, с использованием 2-хлор-4-нитробифенила. МС (ИЭР): рассчитано для C18H11ClN 4O3: 366,1; получено m/z: 367,0 [M+H]+ . 1H ЯМР (600 МГц, DMSO-d6): 13,04 (уш с, 2H); 8,97 (с, 1H); 8,29 (с, 1H); 8,03 (с, 1H); 7,91 (с, 1H); 7,52 (д, J=4,4 Гц, 4H); 7,49-7,45 (м, 1H).

Пример 69: 1-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(6-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 17, стадии А и В, с использованием на стадии А 4-иод-фениламина. МС (ИЭР): рассчитано для C14H11IN4 O3: 410,0; получено m/z: 411,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 9,01 (д, J=0,6 Гц, 1H); 8,39 (д, J=2,0 Гц, 1H); 8,34 (с, 1H); 8,14 (дд, J=8,5, 2,1 Гц, 1H); 7,52 (с, 1H); 4,30 (q, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланил-этоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. В смесь этилового эфира 1-(6-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (500 мг, 1,22 ммоль) и THF (6 мл) при 23°C добавили диизопропилэтиламин (0,425 мл, 2,44 ммоль) и затем 2-(триметилсилил)-этоксиметилхлорид (0,205 мл, 1,34 ммоль). После перемешивания в течение 18 ч реакционную смесь сконцентрировали при пониженном давлении. Полученный остаток очистили КФХ (EtOAc/гексаны от 5 до 45%) и получили искомое соединение (603 мг, 92%). МС (ИЭР): рассчитано для C20H25 IN4O4Si: 540,1; получено m/z: 483,0 [M-CH 2OCH2CH2+H]+. 1 H ЯМР (600 МГц, DMSO-d6): 8,91 (д, J=0,6 Гц, 1H); 8,50 (д, J=2,0 Гц, 1H); 8,30 (д, J=0,6 Гц, 1H); 8,24 (дд, J=8,5, 2,1 Гц, 1H); 7,55 (д, J=8,5 Гц, 1H); 5,61 (с, 2H); 4,29 (кв, J=7,1 Гц, 2H); 3,41-3,37 (м, 2H); 1,30 (т, J=7,1 Гц, 3H); 0,72-0,69 (м, 2H); -0,12 - -0,13 (м, 9H).

Стадия C. Получение этилового эфира 1-[4-оксо-6-о-толил-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь карбоната калия (85,4 мг, 0,618 ммоль), 2-метилфенилборной кислоты (63,3 мг, 0,466 ммоль), этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (110 мг, 0,204 ммоль) и THF (1,5 мл) дегазировали азотом в течение 5 минут в герметично закрываемом реакторе. Затем к реакционной смеси добавили дихлорметановый аддукт 1,1'-бис(дифенилфосфин)ферроцен]дихлорпалладия (20,2 мг, 0,0246 ммоль) и герметично закрыли реактор. Полученную смесь перемешивали при температуре 80°C в течение 18 ч. Затем реакционную смесь охладили до 23°C, разбавили DCM (10 мл) и профильтровали. Полученный фильтрат сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны от 3 до 40%), получив искомое соединение (92,0 мг, 90%). МС (ИЭР): рассчитано для C27H32N4O4Si: 504,22; получено m/z: 446,6 [M-CH2OCH2CH 2+H]+. 1H ЯМР (600 МГц, CDCl 3): 8,68 (д, J=0,6 Гц, 1H); 8,31 - 8,30 (м, 1H); 8,18 (д, J=0,6 Гц, 1H); 7,79 (дд, J=8,3, 2,1 Гц, 1H); 7,76-7,74 (м, 1H); 7,33-7,28 (м, 4H); 5,91 (с, 2H); 4,39-4,35 (м, 2H); 4,37 (кв, J=7,2 Гц, 2H); 2,31 (с, 3H); 1,39 (т, J=7,1 Гц, 3H); 0,83-0,79 (м, 2H); -0,08 (с, 9H).

Стадия D. Получение этилового эфира 1-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К этиловому эфиру 1-[4-оксо-6-о-толил-3-(2-триметилсиланил-этоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (88,0 мг, 0,174 ммоль) добавили раствор HCl в диоксане (4 M, 0,872 мл, 3,48 ммоль). Реакционную смесь перемешивали при 23°C. Через 18 ч реакционную смесь сконцентрировали при пониженном давлении. Затем добавили Et2O (5 мл), полученный осадок собрали фильтрованием и хорошо промыли Et2O, получив искомое соединение (52,0 мг, 80%). МС (ИЭР): рассчитано для C21 H18N4O3: 374,1; получено m/z: 375,2 [M+H]+. 1H ЯМР (600 МГц, CDCl 3): 9,05 (с, 1H); 8,35 (с, 1H); 8,02 (с, 1H); 7,86 (д, J=6,6 Гц, 1H); 7,78 (с, 1H); 7,37-7,28 (м, 4H); 4,31 (кв, J=7,1 Гц, 2H); 2,28 (с, 3H); 1,33 (т, J=7,1 Гц, 3H).

Стадия E. Получение 1-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (40,0 мг, 1,07 ммоль), 1 М водного раствора KOH (0,5 мл) и THF (1 мл) перемешивали в течение 16 ч. Затем реакционную смесь сконцентрировали при пониженном давлении для удаления THF, а оставшуюся водную фазу подкислили до pH 2 добавлением 1 М водного раствора HCl. Образовавшийся осадок собрали фильтрованием, получив искомое соединение (30,0 мг, 81%). МС (ИЭР): рассчитано для C 19H14N4O3: 346,1; получено m/z: 347,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,04 (с, 1H); 12,93 (с, 1H); 8,99 (с, 1H); 8,28 (с, 1H); 8,02 (с, 1H); 7,86 (д, J=7,5 Гц, 1H); 7,76 (д, J=7,8 Гц, 1H); 7,37-7,29 (м, 4H); 2,28 (с, 3H).

Пример 70: 1-(6-дифенил-3-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии С-Е, с использованием этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (продукт из Примера 69, стадия B) и дифенил-3-борной кислоты. МС (ИЭР): рассчитано для C24H16 N4O3: 408,1; получено m/z: 409,1 [M+H] +. 1HЯМР (600 МГц, DMSO-d6 ): 13,01 (с, 1H); 12,92 (с, 1H); 9,00 (с, 1H); 8,44 (с, 1H); 8,32-8,25 (м, 2H); 8,01 (с, 1H); 7,83-7,77 (м, 4H); 7,72 (д, J=7,8 Гц, 1H); 7,62 (т, J=7,7 Гц, 1H); 7,53-7,48 (м, 2H); 7,43-7,40 (м, 1H).

Пример 71: 1-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Суспензию мочевины·H2O2 (941 мг, 11,0 ммоль) в DCM (8,6 мл) охладили на ледяной бане и по каплям добавили трифторуксусный ангидрид (2,4 мл, 17,0 ммоль). Полученную смесь перемешивали в течение 1 часа. Часть полученного раствора трифторнадуксусной кислоты (0,86 мл, 0,86 ммоль) по каплям прибавили к раствору этилового эфира 1-[7-хлор-6-(3,4-диметоксифенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 26, 140 мг, 0,28 ммоль) в DMA (1 мл). Через 16 ч добавили вторую аликвоту раствора трифторнадуксусной кислоты (1 мл, 1 ммоль) и выдержали смесь еще 12 ч. Полученную смесь охладили на ледяной бане и затем добавили воду (15 мл). Образовавшийся осадок собрали фильтрованием и использовали на последующих стадиях без дополнительной очистки.

Стадия B. Получение 1-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Этиловый эфир 1-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты смешали с THF (5 мл) и затем добавили 1 М водный раствор KOH (2,7 мл, 2,7 ммоль) и перемешивали смесь в течение 16 ч. Реакционную смесь охладили на ледяной бане и затем добавили 1 М водный раствор HCl (5 мл) и воду (5 мл). Образовавшийся осадок собрали фильтрованием и очистили ВЭЖХ, получив искомое соединение (16 мг, 12%). МС (ХИ): рассчитано для C20H15 ClN4O7S: 490,0; получено m/z: 489,0 [M-H] -. 1H ЯМР (500 МГц, DMSO-d6): 13,10 (с, 2H); 8,95 (с, 1H); 8,86 (с, 1H); 8,32 (с, 1H); 7,87 (с, 1H); 7,59 (дд, J=8,6, 1,8 Гц, 1H); 7,41 (д, J=2,0 Гц, 1H); 7,19 (д, J=8,6 Гц, 1H); 3,85 (с, 3H); 3,81 (с, 3H).

Пример 72: 1-[6-(4-трет-бутилбензолсульфонил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 71, с использованием этилового эфира 1-[6-(4-трет-бутил-фенилсульфанил)-7-хлор-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 24). МС (ХИ): рассчитано для C22H19ClN4O5S: 486,1; получено m/z: 485,0 [M-H]-. 1H ЯМР (500 МГц, DMSO- d6): 12,97 (с, 1H); 12,77 (с, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 8,14 (д, J=7,9 Гц, 1H); 7,52 (т, J=7,9 Гц, 2H); 7,31 (т, J=7,4 Гц, 1H); 7,22 (д, J=7,7 Гц, 2H); 7,17 (д, J=8,5 Гц, 1H); 6,96 (с, 1H). 13,09 (с, 1H); 8,95 (с, 1H); 8,88 (с, 1H); 8,31 (с, 1H); 7,90 (д, J=8,6, 2H); 7,87 (с, 1H); 7,67 (д, J=8,7, 2H); 1,29 (с, 9H).

Пример 73: 1-(7,7-диметил-4-оксо-3,7-дигидро-4H-8-окса-1,3-диазаантрацен-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии С-Е, с использованием 2,2-диметил-6-амино-2H-1-бензопирана на стадии С и добавлением 4,0 экв. 2,6-ди-трет-бутилпиридина на стадии D. МС (ИЭР): рассчитано для C17H14N4O4: 338,1; получено m/z: 339,1 [M+H]+. 1H ЯМР (500 МГц, DMSO- d6): 12,94 (с, 2H); 8,88 (с, 1H); 8,23 (с, 1H); 7,44 (с, 1H); 7,31 (с, 1H); 6,64 (д, J=9,9 Гц, 1H); 6,10 (д, J=9,9 Гц, 1H); 1,43 (с, 6H).

Пример 74: 1-(4-оксо-6-феноксиметил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии С-Е, с использованием 4-феноксиметиланилина на стадии C и с добавлением 4,0 экв. 2,6-ди-трет-бутилпиридина на стадии D. МС (ИЭР): рассчитано для C19H14 N4O4: 362,1; получено m/z: 363,1 [M+H] +. 1H ЯМР (500 МГц, DMSO-d6): 12,97 (с, 2H); 8,96 (с, 1H); 8,27 (с, 1H); 8,20 (с, 1H); 7,91 (дд, J=8,4, 1,9 Гц, 1H); 7,73 (д, J=8,2 Гц, 1H); 7,35-7,27 (м, 2H); 7,05 (дд, J=8,7, 0,9 Гц, 2H); 6,96 (т, J=7,3 Гц, 1H); 5,27 (с, 2H).

Пример 75: 1-[6-(2,6-диметилфеноксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии С-Е, с использованием 4-(2,6-диметил)феноксиметиланилина на стадии C и с добавлением 4,0 экв. 2,6-ди-трет-бутилпиридина на стадии D. МС (ИЭР): рассчитано для C21H18N4O4: 390,1; получено m/z: 391,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,99 (с, 2H); 8,96 (д, J=12,2 Гц, 1H); 8,26 (д, J=15,8 Гц, 2H); 7,97 (дд, J=8,4, 1,9 Гц, 1H); 7,76 (д, J=7,8 Гц, 1H); 7,11-7,04 (м, 2H); 7,01-6,93 (м, 1H); 4,95 (с, 2H); 2,28 (с, 6H).

Пример 76: 1-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии С-D, с использованием 4-этиниланилина на стадии C и с добавлением 4,0 экв. 2,6-ди-трет-бутилпиридина на стадии D. Сырой продукт содержал смесь искомого соединения и этилового эфира 1-[6-(1-хлорвинил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты в соотношении 2,4:1. Для получения этилового эфира 1-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты часть этой смеси очистили с использованием ВЭЖХ. МС (ИЭР): рассчитано для C16H12N4O 3: 308,1; получено m/z: 309,1 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 12,98 (уш с, 1H); 8,95 (с, 1H); 8,27 (с, 1H); 8,07 (с, 1H); 7,82 (дд, J=8,4, 1,9 Гц, 1H); 7,72-7,54 (м, 1H); 4,31 (с, 1H); 4,23 (кв, J=7,1 Гц, 2H); 1,26 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 27, стадия Е. МС (ИЭР): рассчитано для C14 H8N4O3: 280,1; получено m/z: 281,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,05 (с, 2H); 8,96 (с, 1H); 8,28 (уш с, 1H); 8,13 (уш с, 1H); 7,89 (дд, J=8,4, 2,0 Гц, 1H); 7,79-7,58 (м, 1H); 4,39 (с, 1H).

Пример 77: 1-[6-(1-хлорвинил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 76. МС (ИЭР): рассчитано для C14H9ClN4O3: 317,0; получено m/z: 318,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,05 (с, 3H); 8,97 (с, 1H); 8,41-8,24 (м, 2H); 8,19 (д, J=6,5 Гц, 1H); 7,80-7,64 (м, 1H); 6,29 (м, 1H); 5,77 (д, J=2,6 Гц, 1H).

Пример 78: 1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 3-нитрофенил-фенилсульфида. Смесь тиофенола (1,0 г, 9,1 ммоль), 3-иоднитробензола (1,9 г, 7,6 ммоль), CuI (0,14 г, 0,76 ммоль), K2CO3 (1,67 г, 12,1 ммоль) и DMF (10 мл) выдержали при 100°C в течение 16 ч в герметично закрытом реакторе, высушенном способом огневой сушки. Полученной смеси дали остыть и вылили на лед. Полученную смесь экстрагировали EtOAc (2X), полученные органические экстракты объединили и промыли последовательно равными объемами 1 М водного раствора HCl, воды и 1 М водного раствора NaOH. Полученный раствор высушили, сконцентрировали, и полученный остаток очистили КФХ (гексаны/EtOAc от 100:0 до 95:5), получив искомое соединение, которое содержало в качестве примеси ок. 10% тиофенола (1,43 г) и использовалось на последующих стадиях без дополнительной очистки.

Стадия В. Получение 3-фенилсульфанил-фениламина. 3-Нитрофенил-фенилсульфид, полученную на стадии A смесь чистотой ок. 90% (1,43 г, 6,2 ммоль), растворили в ацетоне (20 мл) и охладили на ледяной бане. Затем добавили насыщенный раствор NH4 Cl (5 мл), после чего при энергичном перемешивании в течение 5 мин небольшими порциями добавили цинковую пыль (3,7 г, 56 ммоль). Ледяной бане дали растаять, и перемешивали полученную смесь в течение 16 ч. Затем к смеси добавили EtOAc (200 мл) и затем безводный сульфат натрия (20 г). Перемешивание продолжали еще 1 ч, после чего смесь профильтровали через слой силикагеля, используя в качестве элюента дополнительное количество EtOAc. Полученный прозрачный раствор сконцентрировали, и полученный остаток очистили КФХ (гексаны/EtOAc от 99:1 до 70:30), получив искомое соединение (1,43 г, 69%). МС (ИЭР): рассчитано для C12H11 NS: 201,3; получено m/z: 202,1 [M+H]+.

Стадия C. Получение этилового эфира 1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили в соответствии со способами, описанными в Примере 27, стадии C-D, с использованием на стадии С 3-тиофениланилина. МС (ИЭР): рассчитано для C20H 16N4O3S: 392,4; получено m/z: 393,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6 ): 12,94 (с, 1H); 8,97 (с, 1H); 8,30 (с, 1H); 8,03 (д, J=8,4 Гц, 1H); 7,66-7,58 (м, 2H); 7,58-7,51 (м, 3H); 7,29 (дд, J=8,4, 1,8 Гц, 1H); 7,22 (с, 1H); 4,28 (кв, J=7,1 Гц, 2H); 1,31 (т, J=7,1 Гц, 3H).

Стадия D. Получение 1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили в соответствии со способами, описанными в Примере 27, стадия E, с использованием 1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. МС (ИЭР): рассчитано для C18H12 N4O3S: 363,0; получено m/z: 365,1 [M+H] +. 1H ЯМР (500 МГц, DMSO- d6): 13,09-12,70 (м, 2H); 8,90 (с, 1H); 8,24 (с, 1H); 8,03 (д, J=8,4 Гц, 1H); 7,64-7,59 (м, 2H); 7,57-7,52 (м, 3H); 7,28 (дд, J=8,4, 1,8 Гц, 1H); 7,21 (уш с, 1H).

Пример 79: 1-[7-(4-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 78, с использованием на стадии А 4-хлортиофенола. МС (ИЭР): рассчитано для C18H 11ClN4O3S: 398,0; получено m/z: 399,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6 ): 13,09-12,78 (м, 2H); 8,93 (с, 1H); 8,25 (с, 1H); 8,04 (д, J=8,2 Гц, 1H); 7,64-7,57 (м, 4H); 7,34-7,23 (м, 2H).

Пример 80: 1-[7-(2-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 78, с использованием на стадии А 2-хлортиофенола. МС (ИЭР): рассчитано для C18H 11ClN4O3S: 398,0; получено m/z: 399,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6 ): 13,18-12,66 (м, 2H); 8,92 (с, 1H); 8,25 (с, 1H); 8,07 (д, J=8,3 Гц, 1H); 7,72 (дд, J=8,0, 1,3 Гц, 1H); 7,65 (дд, J=7,7, 1,6 Гц, 1H); 7,55 (тд, J=7,7, 1,7 Гц, 1H); 7,48 (тд, J=7,6, 1,4 Гц, 1H); 7,30 (дд, J=8,4, 1,8 Гц, 1H); 7,24 (с, 1H).

Пример 81: 1-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. В раствор этилового эфира 1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (Пример 78, продукт, полученный на стадии C, 130 мг, 0,33 ммоль) в DCM (10 мл) добавили mCPBA в виде твердого вещества (305 мг, 0,133 ммоль). Реакцию вели при комнатной температуре в течение 16 часов. Затем реакционную смесь разбавили DCM, промыли насыщенным водным раствором тиосульфата натрия, насыщенным водным раствором NaHCO3, высушили и сконцентрировали. Полученный сырой продукт использовали без дополнительной очистки (52 мг, 37%). МС (ИЭР): рассчитано для C20H16N 4O5S: 424,1; получено m/z: 425,1 [M+H]+ .

Стадия B. Получение 1-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (50 мг, 0,12 ммоль), ТГФ (2 мл) и 1 М водного раствора LiOH (0,6 мл, 0,6 ммоль) перемешивали в течение 16 ч. Затем удалили THF при пониженном давлении и добавили 1 М водный раствор HCl (3 мл, 3 ммоль). Образовавшийся сырой продукт собрали фильтрованием и очистили ВЭЖХ, получив искомое соединение (7,0 мг, 14 %). МС (ИЭР): рассчитано для C18H12N4 O5S: 396,1; получено m/z: 397,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,43-12,81 (м, 2H); 8,99 (с, 1H); 8,34-8,25 (м, 2H); 8,18 (с, 1H); 8,05 (д, J=7,6 Гц, 2H); 7,96 (дд, J=8,3, 1,5 Гц, 1H); 7,78-7,71 (м, 1H); 7,71-7,63 (м, 2H).

Пример 82: 1-[7-(4-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 81, с использованием на стадии А этилового эфира 1-[7-(4-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 79). МС (ИЭР): рассчитано для C18H11ClN4O5S: 430,0; получено m/z: 431,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,06 (уш с, 2H); 8,99 (с, 1H); 8,35-8,25 (м, 2H); 8,19 (с, 1H); 8,08 (д, J=8,4 Гц, 2H); 7,97 (дд, J=8,3 Гц, 1,7, 1H); 7,78-7,71 (м, 2H).

Пример 83: 1-[7-(2-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 81, с использованием этилового эфира 1-[7-(2-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 80). МС (ИЭР): рассчитано для C18H11ClN4O5S: 430,0; получено m/z: 431,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,40-12,82 (м, 2H); 9,02 (с, 1H); 8,39 (д, J=7,8 Гц, 1H); 8,36-8,25 (м, 2H); 8,12 (с, 1H); 7,90 (д, J=8,3 Гц, 1H); 7,84-7,66 (м, 3H).

Пример 84: 1-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 2-(2-хлор-4-нитрофенил)-1,2,3,4-тетрагидроизохинолина. Смесь 3,4-дихлорнитробензола (1,0 г, 5,2 ммоль), 1,2,3,4-тетрагидроизохинолина (0,97 г, 7,3 ммоль), K2CO3 (3,6 г, 26 ммоль) и DMSO (20 мл) при перемешивании выдержали при 80°C в течение 16 ч. Затем смеси дали остыть до комнатной температуры и вылили на лед. Выпавший осадок собрали фильтрованием и получили искомое соединение (1,5 г, 98%). МС (ИЭР): рассчитано для C15 H13ClN2O2: 288,7; получено m/z: 289,1 [M+H]+.

Стадия B. Получение 2-(2-хлор-4-аминофенил)-1,2,3,4-тетрагидроизохинолина. Смесь 2-(2-хлор-4-нитрофенил)-1,2,3,4-тетрагидроизохинолина (1,4 г, 4,8 ммоль), насыщенного водного раствора хлорида аммония (5 мл) и ацетона (20 мл) охладили на ледяной бане. Затем в течение 10 мин при перемешивании небольшими порциями добавили цинковую пыль (3,2 г, 48 ммоль). Ледяной бане дали растаять, и перемешивали полученную смесь в течение 16 ч. Затем к смеси добавили EtOAc (200 мл) и затем безводный сульфат натрия (20 г). Смесь перемешали в течение 15 мин и профильтровали через слой силикагеля, используя в качестве элюента дополнительное количество EtOAc. Полученный прозрачный раствор сконцентрировали, получив искомое соединение (1,2 г, 96%). 1H ЯМР (500 МГц, CDCl3): 7,20-7,11 (м, 3H); 7,11-7,04 (м, 1H); 6,95 (д, J=8,5 Гц, 1H); 6,78 (д, J=2,7 Гц, 1H); 6,56 (дд, J=8,5, 2,7 Гц, 1H); 4,17 (с, 2H); 3,55 (с, 2H); 3,27 (т, J=5,8 Гц, 2H); 3,00 (т, J=5,8 Гц, 2H).

Стадия C. Получение этилового эфира 1-{[4-хлор-3-(3,4-дигидро-1H-изохинолин-2-ил)-бензоиламино]-этоксикарбонилиминометил}-1H-пиразол-4-карбоновой кислоты. Раствор 2-(2-хлор-4-аминофенил)-1,2,3,4-тетрагидроизохинолина (1,2 г, 4,6 ммоль) и этилизотиоцианатформата (0,61 г, 4,6 ммоль) в DCM (20 мл) выдержали при комнатной температуре в течение 16 ч. Затем реакционную смесь сконцентрировали до сухого состояния и повторно растворили в DCM (20 мл). К полученной смеси добавили этилпиразол-4-карбоксилат (0,98 г, 10 ммоль), триэтаноламин (ТЭА) (1,4 г, 14 ммоль), EDCI (1,3 г, 7,0 ммоль) и выдержали в течение 4 ч для протекания реакции. Затем смесь разбавили EtOAc (200 мл), промыли равными объемами воды (2X) и насыщенного солевого раствора, высушили и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны от 1:99 до 30:70) с получением частично чистого гуанидинового промежуточного соединения (1,2 г, 52%).

Стадия D. Получение этилового эфира 1-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Раствор этилового эфира 1-{[4-хлор-3-(3,4-дигидро-1H-изохинолин-2-ил)-бензоиламино]-этоксикарбонилиминометил}-1H-пиразол-4-карбоновой кислоты (1,2 г, 2,4 ммоль) в смеси DCE (5 мл) и хлортриметилсилана (2,8 мл, 22 ммоль) выдержали при 110°C в герметично закрытом реакторе в течение 16 ч. Затем реактор с содержимым выдержали на ледяной бане в течение 1 ч и полученный осадок собрали фильтрованием, промыли холодным DCE и высушили в вакууме, получив искомое соединение (0,40 г, 19%). МС (ИЭР): рассчитано для C23H20 ClN5O3: 449,9; получено m/z: 450,1 [M+H] +.

Стадия E. Получение 1-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,35 г, 0,78 ммоль), THF (12 мл) и 1 М водного раствора LiOH (7,8 мл, 7,8 ммоль) перемешивали при комнатной температуре в течение 16 ч. Затем THF удалили, а водную фазу охладили на ледяной бане. pH полученной смеси довели до ок. pH 5 при помощи 1 М водного раствора HCl, полученный осадок собрали, тщательно промыли водой и высушили, получив искомое соединение (0,33 г, 99%). МС (ИЭР): рассчитано для C21H16ClN 5O3: 421,1; получено m/z: 422,1 [M+H]+ . 1H ЯМР (500 МГц, DMSO-d6): 13,22-12,69 (уш м, 2H); 8,92 (с, 1H); 8,25 (с, 1H); 7,88-7,73 (м, 2H); 7,24-7,16 (м, 4H); 4,31 (с, 2H); 3,39 (т, J=5,6 Гц, 2H); 3,00 (т, J=5,5 Гц, 2H).

Пример 85: 1-[6-(7-бром-3,4-дигидро-1H-изохинолин-2-ил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 84, с использованием на стадии А 7-бром-1,2,3,4-тетрагидроизохинолина и 2,3-дихлорнитробензола. МС (ИЭР): рассчитано для C21H15BrClN 5O3: 499,0; получено m/z: 500,0 [M+H]+ . 1H ЯМР (500 МГц, DMSO-d6): 12,93 (с, 2H); 8,92 (с, 1H); 8,25 (с, 1H); 7,80 (с, 2H); 7,47 (с, 1H); 7,38 (д, J=8,1 Гц, 1H); 7,17 (д, J=8,2 Гц, 1H); 4,31 (с, 2H); 3,45-3,35 (м, 3H); 3,01-2,90 (м, 2H).

Пример 86: (рац)-1-{7-хлор-6-[3-(3-метоксифенил)-пиперидин-1-ил]-4-оксо-3,4-дигидрохиназолин-2-ил}-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 84, с использованием на стадии А 3-(3-метоксифенил)пиперидина и 2,3-дихлорнитробензола. МС (ИЭР): рассчитано для C24H22ClN5O 4: 479,1; получено m/z: 480,2 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 13,32-12,61 (уш м, 2H); 8,90 (с, 1H); 8,24 (с, 1H); 7,76 (с, 1H); 7,72 (с, 1H); 7,23 (т, J=7,9 Гц, 1H); 6,96-6,88 (м, 2H); 6,84-6,76 (м, 1H); 3,75 (с, 3H); 3,43-3,36 (м, 2H); 2,96 (т, J=11,3 Гц, 1H); 2,89-2,72 (м, 2H); 2,02-1,74 (м, 3H); 1,73-1,58 (м, 1H).

Пример 87: 1-[6-(2,5-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 2,5-дихлорфенола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C18H9Cl2FN4O 4: 434,0; получено m/z: 434,9 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,09 (с, 2H); 8,92 (с, 1H); 8,27 (с, 1H); 7,75 (д, J=11,4 Гц, 1H); 7,72 (д, J=8,6 Гц, 1H); 7,54 (д, J=8,8 Гц, 1H); 7,44 (д, J=2,4 Гц, 1H); 7,40 (дд, J=8,6, 2,4 Гц, 1H).

Пример 88: 1-[6-(3,4-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3,4-диметилфенола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C20H15FN4O4:394,1; получено m/z: 395,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,04 (с, 1H); 13,04-12,92 (м, 1H); 8,91 (с, 1H); 8,26 (с, 1H); 7,70 (д, J=11,5 Гц, 1H); 7,47 (д, J=8,9 Гц, 1H); 7,22 (д, J=8,2 Гц, 1H); 6,99 (д, J=2,7 Гц, 1H); 6,89 (дд, J=8,2, 2,7 Гц, 1H); 2,24 (с, 6H).

Пример 89: 1-[6-(3,5-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3,5-диметилфенола и 4-фтор-3-метилнитробензола. МС (ИЭР): рассчитано для C21H18N4O4: 390,1; получено m/z: 391,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,99 (с, 2H); 8,91 (с, 1H); 8,24 (с, 1H); 7,66 (с, 1H); 7,30 (с, 1H); 6,86 (с, 1H); 6,70 (с, 2H); 2,39 (с, 3H); 2,27 (с, 6H).

Пример 90: 1-[6-(2,5-дихлорфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 2,5-дихлорфенола и 4-фтор-3-метилнитробензола. МС (ИЭР): рассчитано для C19H12Cl2N4O 4: 430,0; получено m/z: 431,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,02 (с, 1H); 12,87 (с, 1H); 8,92 (с, 1H); 8,25 (с, 1H); 7,72 (д, J=8,6 Гц, 2H); 7,40 (дд, J=8,6, 2,4 Гц, 1H); 7,35 (д, J=2,2 Гц, 1H); 7,23 (с, 1H); 2,43 (с, 3H).

Пример 91: 1-[6-(дифенил-3-илокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3-фенилфенола и 4-фтор-3-метилнитробензола. МС (ИЭР): рассчитано для C25H18N4O4: 438,1; получено m/z: 439,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,91 (с, 2H); 8,91 (с, 1H); 8,22 (с, 1H); 7,72-7,65 (м, 3H); 7,54 (дд, J=3,8, 2,3 Гц, 2H); 7,46 (т, J=7,5 Гц, 2H); 7,41-7,37 (м, 3H); 7,10-7,03 (м, 1H); 2,43 (с, 3H).

Пример 92: 1-[6-(3,4-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3,4-диметилфенола и 4-фтор-3-метилнитробензола. МС (ИЭР): рассчитано для C21H18N4O4: 390,1; получено m/z: 391,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,01 (с, 1H); 12,77 (с, 1H); 8,90 (с, 1H); 8,24 (с, 1H); 7,65 (с, 1H); 7,23 (с, 1H); 7,21 (д, J=8,3 Гц, 1H); 6,93 (д, J=2,4 Гц, 1H); 6,83 (дд, J=8,1, 2,5 Гц, 1H); 2,41 (с, 3H); 2,23 (с, 6H).

Пример 93: 1-[7-метил-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3-трифторметилфенола и 4-фтор-3-метилнитробензола. МС (ИЭР): рассчитано для C20H13F3N 4O4: 430,0; получено m/z: 431,0 [M+H]+ . 1H ЯМР (400 МГц, DMSO-d6): 13,03 (с, 1H); 12,97-12,44 (м, 1H); 8,92 (с, 1H); 8,26 (с, 1H); 7,71 (д, J=5,1 Гц, 1H); 7,68 (т, J=8,0 Гц, 1H); 7,57 (д, J=7,8 Гц, 1H); 7,43 (с, 2H); 7,36 (д, J=8,2 Гц, 1H); 2,38 (с, 3H).

Пример 94: 1-[6-(3,5-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3,5-диметилфенола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C20H15FN4O4: 394,1; получено m/z: 395,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,02 (с, 1H); 13,02-12,88 (м, 1H); 8,92 (с, 1H); 8,26 (с, 1H); 7,71 (д, J=11,4 Гц, 1H); 7,56 (д, J=8,9 Гц, 1H); 6,88 (с, 1H); 6,76 (с, 2H); 2,28 (с, 6H).

Пример 95: 1-[7-фтор-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3-трифторметилфенола и 3,4-дифторнитробензола. МС (ИЭР): рассчитано для C19H10F4N4O 4: 434,1; ион-предшественник не обнаружен. 1 H ЯМР (400 МГц, DMSO-d6): 13,07 (с, 2H); 8,93 (с, 1H); 8,28 (с, 1H); 7,75 (дд, J=10,1, 5,0 Гц, 2H); 7,69 (т, J=8,0 Гц, 1H); 7,60 (д, J=7,8 Гц, 1H); 7,52 (с, 1H); 7,44 (дд, J=8,2, 2,1 Гц, 1H).

Пример 96: 1-[6-(2-фтор-3-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 2-фтор-3-трифторметилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C19H10F4N 4O4: 434,1; ион-предшественник не обнаружен. 1H ЯМР (400 МГц, DMSO-d6): 13,02 (с, 2H); 8,95 (с, 1H); 8,26 (с, 1H); 7,78 (с, 1H); 7,73-7,60 (м, 3H); 7,54 (с, 1H); 7,49 (т, J=8,2 Гц, 1H).

Пример 97: 1-[6-(3-фтор-5-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3-фтор-5-трифторметилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C19H10F4N 4O4: 434,0; получено m/z: 435,0 [M+H]+ . 1H-ЯМР (400 МГц, DMSO-d6): 13,03 (с, 2H); 8,96 (с, 1H); 8,27 (с, 1H); 7,79 (с, 1H); 7,71-7,66 (м, 2H); 7,54 (д, J=8,4 Гц, 1H); 7,39 (д, J=9,9 Гц, 1H); 7,33 (с, 1H).

Пример 98: 1-[6-(3,5-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3,5-диметилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C20H16N4O4: 376,1; получено m/z: 377,1 [M+H]+. 1H-ЯМР (400 МГц, DMSO-d6): 13,01 (с, 1H); 12,91 (с, 1H); 8,94 (с, 1H); 8,25 (с, 1H); 7,73 (д, J=8,2 Гц, 1H); 7,57 (дд, J=8,9, 2,9 Гц, 1H); 7,43 (с, 1H); 6,89 (с, 1H); 6,75 (с, 2H); 2,28 (с, 6H).

Пример 99: 1-[6-(бифенил-3-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3-фенилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C24H16N4O4: 424,1; получено m/z: 425,1 [M+H]+. 1H-ЯМР (400 МГц, DMSO-d6): 12,96 (с, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,77 (д, J=8,9 Гц, 1H); 7,69 (д, J=7,7 Гц, 2H); 7,64 (дд, J=8,9, 2,7 Гц, 1H); 7,56 (д, J=4,7 Гц, 2H); 7,53 (д, J=2,8 Гц, 1H); 7,50-7,42 (м, 3H); 7,39 (т, J=7,3 Гц, 1H); 7,18-7,10 (м, 1H).

Пример 100: 1-[4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 3-трифторметилфенола и 4-фторнитробензола. МС (ИЭР): рассчитано для C19H11F3N4O 4: 416,0; получено m/z: 417,0 [M+H]+. 1 H-ЯМР (400 МГц, DMSO-d6): 13,02 (с, 2H); 8,95 (с, 1H); 8,27 (с, 1H); 7,79 (д, J=8,9 Гц, 1H); 7,69 (т, J=8,0 Гц, 1H); 7,65 (дд, J=8,9, 2,9 Гц, 1H); 7,60 (д, J=7,8 Гц, 1H); 7,57 (д, J=2,9 Гц, 1H); 7,49 (с, 1H); 7,44 (д, J=8,1 Гц, 1H).

Пример 101: 1-[6-(2,6-дихлорфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А 2,6-дихлорфенола и 3,4,5-трифторнитробензола. МС (ИЭР): рассчитано для C18H8Cl2F2N 4O4: 452,0; ион-предшественник не обнаружен. 1H-ЯМР (500 МГц, DMSO-d6): 13,06 (с, 2H); 8,91 (с, 1H); 8,27 (с, 1H); 7,63 (д, J=8,2 Гц, 2H); 7,57 (д, J=11,6 Гц, 1H); 7,35 (т, J=8,2 Гц, 1H).

Пример 102: 1-(6-циклогексилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 27, с использованием на стадии А циклогексанола и 4-фторнитробензола. МС (ИЭР): рассчитано для C18H18N4O4: 354,1; получено m/z: 355,1 [M+H]+. 1H-ЯМР (400 МГц, DMSO-d6): 12,92 (с, 1H); 12,85-12,50 (м, 1H); 8,91 (с, 1H); 8,22 (с, 1H); 7,63 (д, J=8,0 Гц, 1H); 7,52 (д, J=2,7 Гц, 1H); 7,45 (дд, J=8,9, 2,8 Гц, 1H); 4,50 (с, 1H); 1,95 (с, 2H); 1,73 (с, 2H); 1,55-1,42 (м, 4H); 1,31-1,22 (м, 2H).

Пример 103: 1-[6-(4-метилпиперазин-1-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 17, с использованием на стадии А 4-(4-метилпиперазин-1-ил)-анилина. МС (ИЭР): рассчитано для C17H18N6O3: 354,1; получено m/z: 355,2 [M+H]+. 1H-ЯМР (400 МГц, DMSO-d6): 12,88-11,90 (м, 2H); 8,79 (с, 1H); 7,91 (с, 1H); 7,64-7,20 (м, 3H); 3,15 (д, J=4,8 Гц, 4H); 2,24 (с, 3H).

Пример 104: 1-(6-изопропокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 17, с использованием на стадии А 4-изопропоксианилина. МС (ИЭР): рассчитано для C15 H14N4O4: 314,1; получено m/z: 315,1 [M+H]+. 1H-ЯМР (500 МГц, DMSO-d 6): 12,96 (с, 1H); 12,76 (с, 1H); 8,92 (с, 1H); 8,23 (с, 1H); 7,63 (д, J=8,7 Гц, 1H); 7,51 (с, 1H); 7,43 (д, J=8,9 Гц, 1H); 4,90-4,61 (м, 1H); 1,32 (д, J=6,0 Гц, 6H).

Пример 105: 1-(6-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 17, с использованием на стадии А 4-бензиланилина. МС (ИЭР): рассчитано для C19H 14N4O3: 346,1; получено m/z: 347,1 [M+H]+. 1H-ЯМР (500 МГц, DMSO-d6 ): 12,99 (с, 1H); 12,77 (с, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 7,96 (с, 1H); 7,73 (д, J=8,0 Гц, 1H); 7,62 (д, J=8,1 Гц, 1H); 7,34-7,28 (м, 4H); 7,21 (т, J=6,9 Гц, 1H); 4,11 (с, 2H).

Пример 106: 1-(4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 17, с использованием на стадии А 4-аминобифенила. МС (ИЭР): рассчитано для C18H 12N4O3: 332,1; получено m/z: 333,1 [M+H]+. 1H-ЯМР (500 МГц, DMSO-d6 ): 13,03 (с, 1H); 12,92 (с, 1H); 8,98 (с, 1H); 8,34 (с, 1H); 8,28 (с, 1H); 8,17 (д, J=8,3 Гц, 1H); 7,79 (д, J=7,4 Гц, 3H); 7,53 (т, J=7,7 Гц, 2H); 7,43 (т, J=7,4 Гц, 1H).

Пример 107: 1-(6-морфолин-4-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 17, с использованием на стадии А 4-(1-морфолино)-анилина. МС (ИЭР): рассчитано для C16 H15N5O4: 341,1; получено m/z: 342,1 [M+H]+. 1H-ЯМР (500 МГц, DMSO-d 6): 12,95 (с, 1H); 12,63 (с, 1H); 8,90 (с, 1H); 8,22 (с, 1H); 7,60 (с, 2H); 7,43 (д, J=24,2 Гц, 1H); 3,84-3,72 (м, 4H); 3,27-3,21 (м, 4H).

Пример 108: 1-[6-(1H-индол-6-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили в соответствии со способами, описанными в Примере 69, стадии C-E, с использованием на стадии С этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (продукт из Примера 69, полученный на стадии B) и индол-6-борной кислоты. МС (ИЭР): рассчитано для C20H13 N5O3: 371,1; получено m/z: 372,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 13,01 (с, 1H); 12,86 (с, 1H); 11,23 (с, 1H); 8,99 (с, 1H); 8,37 (с, 1H); 8,27 (с, 1H); 8,20 (с, 1H); 7,77 (с, 2H); 7,67 (д, J=8,2 Гц, 1H); 7,43 (с, 2H); 6,48 (с, 1H).

Пример 109: 1-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[(4-бромфенилимино)-этоксикарбониламинометил]-1H-пиразол-4-карбоновой кислоты. К раствору 4-бромфениламина (1,91 г, 11,1 ммоль) в DCM (37 мл) добавили этилизотиоцианатформат (1,44 мл, 12,2 ммоль). Через 1 ч к реакционной смеси добавили триэтиламин (4,65 мл, 33,4 ммоль) и затем этилпиразол-4-карбоксилат (1,87 г, 13,3 ммоль) и EDCI (3,20 г, 16,7 ммоль). Через 18 ч реакционную смесь разбавили DCM (150 мл), промыли насыщенным солевым раствором (50 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 5-40%) и получили искомое соединение (1,84 г, выход 40%). МС (ИЭР/ХИ): рассчитано для C16H 17BrN4O4: 408,1; получено m/z: 409,1 [M+H]+.

Стадия B. Получение этилового эфира 1-(6-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[(4-бромфенилимино)-этоксикарбониламинометил]-1H-пиразол-4-карбоновой кислоты (1,84 г, 4,50 ммоль) и DCE (45 мл) осторожно добавили хлорид титана (IV) (2,47 мл, 22,5 ммоль) и выдержали полученный раствор при 100°C в течение 15 ч. Реакционную смесь охладили до комнатной температуры и вылили в ледяную воду (50 мл), после чего добавили DCM (100 мл). Полученную двухфазную смесь перемешивали в течение 2 ч и затем разделили слои. Водную фазу далее экстрагировали DCM (2 x 50 мл). Объединенные органические фазы промыли насыщенным солевым раствором (50 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток растерли из EtOH и получили искомое соединение (1,05 г, выход 64%). МС (ИЭР/ХИ): рассчитано для C14 H11BrN4O3: 362,0; получено m/z: 363,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,15 (с, 1H); 9,01 (д, J=0,5 Гц, 1H); 8,33 (с, 1H); 8,20 (д, J=2,3 Гц, 1H); 7,99 (дд, J=8,7, 2,4 Гц, 1H); 7,66 (д, J=8,8 Гц, 1H); 4,30 (кв, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия C. Получение этилового эфира 1-[6-бром-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-(6-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,980 г, 2,70 ммоль) в THF (13,5 мл) добавили DIEA (1,23 мл, 7,08 ммоль) и затем (2-хлорметоксиэтил)-триметилсилан (0,500 мл, 3,27 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 0-20%) и получили искомое соединение (1,27 г, выход 95%). МС (ИЭР/ХИ): рассчитано для C20 H25BrN4O4Si: 492,1; получено m/z: 435,1 [M-58+H]+.

Стадия D. Получение этилового эфира 1-[6-циклопропил-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-[6-бром-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,500 г, 1,01 ммоль), циклопропилборной кислоты (0,199 г, 2,32 ммоль), дихлорметанового аддукта дихлор(1,1'-бис(дифенилфосфино)ферроцен)палладия (II) (0,100 г, 0,123 ммоль), K2CO3 (0,420 г, 3,04 ммоль) и THF (10 мл) продували азотом в течение 15 минут и затем выдержали при 80°C в течение 15 ч. Затем смесь охладили до комнатной температуры и профильтровали через слой CELITE ®. Отфильтрованный осадок промыли дихлорметаном и сконцентрировали. Полученный остаток очисти КФХ (EtOAc/гексаны 0-20%) и получили искомое соединение (0,120 г, выход 26%). МС (ИЭР/ХИ): рассчитано для C23H30N4 O4Si: 454,2; получено m/z: 455,2 [M+H]+ .

Стадия E. Получение этилового эфира 1-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К этиловому эфиру 1-[6-циклопропил-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,12 г, 0,264 ммоль) добавили HCl (4 M в диоксане, 1,32 мл, 5,28 ммоль). Реакционную смесь перемешивали 1 ч при комнатной температуре и сконцентрировали. Полученный остаток растерли с диэтиловым эфиром (10 мл), выпавший осадок собрали и высушили, получив искомое соединение (0,072 г, выход 84%). МС (ИЭР/ХИ): рассчитано для C17H16N4O 3: 324,1; получено m/z: 325,1 [M+H]+. 1 H ЯМР (600 МГц, DMSO-d6): 12,81 (с, 1H); 8,99 (д, J=0,5 Гц, 1H); 8,30 (с, 1H); 7,81 (с, 1H); 7,65-7,50 (м, 2H); 4,30 (кв, J=7,1 Гц, 2H); 2,17-2,03 (м, 1H); 1,32 (т, J=7,1 Гц, 3H); 1,09-0,99 (м, 2H); 0,81-0,72 (м, 2H).

Стадия F: 1-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота. Смесь этилового эфира 1-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,045 г, 0,139 ммоль), 1 М водного раствора KOH (0,694 мл) и THF (0,694 мл) перемешивали в течение 18 ч. Затем смесь сконцентрировали для удаления THF, а оставшуюся водную фазу подкислили путем добавления 6 М водного раствора HCl при температуре 0°C. Выпавший осадок собрали фильтрованием, получив искомое соединение (0,035 г, 85%). МС (ИЭР/ХИ): рассчитано для C15H 12N4O3: 296,1; получено m/z: 297,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6 ): 12,92 (с, 2H); 8,93 (д, J=0,5 Гц, 1H); 8,24 (с, 1H); 7,81 (с, 1H); 7,65-7,50 (м, 2H); 2,22-2,04 (м, 1H); 1,14-0,94 (м, 2H); 0,85-0,68 (м, 2H).

Пример 110: 1-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(6-бром-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А и В), с использованием на стадии A 4-бром-3-фторфениламина. МС (ИЭР/ХИ): рассчитано для C14H10BrFN 4O3: 380,0; получено m/z: 381,0 [M+H]+ . 1H ЯМР (400 МГц, CDCl3): 10,29 (с, 1H); 8,99 (д, J=0,6 Гц, 1H); 8,51 (д, J=7,4 Гц, 1H); 8,15 (д, J=0,5 Гц, 1H); 7,40 (д, J=9,0 Гц, 1H); 4,38 (кв, J=7,1 Гц, 2H); 1,40 (т, J=7,1 Гц, 3H).

Стадия B. Получение этилового эфира 1-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К THF (5 мл) добавили 1 М раствора ZnCl2 в эфире (5,00 мл, 5,00 ммоль) и затем 2 M раствора циклогексилмагнийхлорида в эфире (2,50 мл, 5,00 ммоль). Реакционную смесь перемешивали в течение ночи при комнатной температуре. Затем перемешивание прекратили и выдержали смесь, дождавшись выпадения всего осадка на дно колбы. В другой колбе к смеси ацетата палладия (11,8 мг, 0,053 ммоль), Ru-Phos (48,9 мг, 0,105 ммоль) и этилового эфира 1-(6-бром-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,200 г, 0,525 ммоль) добавили THF (4 мл) и продули содержимое колбы азотом в течение 5 минут. Затем добавили циклогексилцинкхлорид (5,25 мл, 2,62 ммоль), полученный, как описано выше, и перемешивали смесь в течение 18 ч. Сырую реакционную смесь вылили в EtOH (10 мл) и подкислили, медленно добавляя 6 М водного раствора HCl (1 мл). Выпавший осадок собрали фильтрованием, растерли с EtOH и еще раз отфильтровали, получив искомое соединение (0,110 г, 54%). МС (ИЭР/ХИ): рассчитано для C20H21 FN4O3: 384,2; получено m/z: 385,2 [M+H] +.

Стадия C. Получение 1-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадия F), с использованием этилового эфира 1-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. МС (ИЭР/ХИ): рассчитано для C18H17 FN4O3: 356,1; получено m/z: 357,1 [M+H] +. 1H ЯМР (400 МГц, DMSO-d6): 13,01 (с, 2H); 8,92 (д, J=0,6 Гц, 1H); 8,26 (с, 1H); 8,03 (д, J=8,1 Гц, 1H); 7,45 (д, J=11,2 Гц, 1H); 2,89 (т, J=11,7 Гц, 1H); 1,84 (д, J=8,4 Гц, 4H); 1,73 (д, J=12,7 Гц, 1H); 1,59-1,16 (м, 5H).

Пример 111: 1-(4-оксо-8-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А дифенил-2-иламина. МС (ИЭР/ХИ): рассчитано для C 18H12N4O3: 332,1; получено m/z: 333,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,00 (с, 2H); 8,58 (с, 1H); 8,24 (с, 1H); 8,18 (д, J=7,9 Гц, 1H); 7,89 (д, J=7,4 Гц, 1H); 7,70 (д, J=8,1 Гц, 2H); 7,60 (т, J=7,7 Гц, 1H); 7,52 (т, J=7,6 Гц, 2H); 7,46-7,43 (м, 1H).

Пример 112: 1-(4-оксо-8-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 2-феноксифениламина. МС (ИЭР/ХИ): рассчитано для C18H12N4O4: 348,1; получено m/z: 349,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,97 (с, 2H); 8,41 (с, 1H); 8,21 (с, 1H); 8,02-7,88 (м, 1H); 7,51 (дд, J=7,4, 6,0 Гц, 2H); 7,39-7,36 (м, 2H); 7,11 (т, J=7,4 Гц, 1H); 7,02 (д, J=7,8 Гц, 2H).

Пример 113: 1-(4-оксо-8-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 2-фенилсульфанилфениламина. МС (ИЭР/ХИ): рассчитано для C18H12N4O3S: 364,1; получено m/z: 365,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,06 (с, 2H); 8,76 (д, J=0,6 Гц, 1H); 8,27 (д, J=0,6 Гц, 1H); 7,92 (дд, J=7,9 Гц, 1,3, 1H); 7,60-7,42 (м, 5H); 7,36 (т, J=7,8 Гц, 1H); 7,17 (д, J=7,7 Гц, 1H).

Пример 114: 1-(8-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 2-изопропилфениламина. МС (ИЭР/ХИ): рассчитано для C15H14N4O3: 298,1; получено m/z: 299,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,92 (с, 2H); 9,00 (с, 1H); 8,26 (с, 1H); 8,00 (дд, J=7,9, 1,3 Гц, 1H); 7,76 (д, J=7,4 Гц, 1H); 7,48 (т, J=7,7 Гц, 1H); 4,03-3,93 (м, 1H); 1,30 (д, J=6,9 Гц, 6H).

Пример 115: 1-(8-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 2-трет-бутилфениламина. МС (ИЭР/ХИ): рассчитано для C16H16N4O3: 312,1; получено m/z: 313,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,01 (с, 2H); 8,82 (с, 1H); 8,28 (с, 1H); 8,06 (дд, J=7,9, 1,4 Гц, 1H); 7,79 (дд, J=7,7, 1,4 Гц, 1H); 7,45 (т, J=7,8 Гц, 1H); 1,58 (с, 9H).

Пример 116: 1-(5,8-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 2,5-дифторфениламина. МС (ИЭР/ХИ): рассчитано для C12H6F2N4O3 : 292,0; получено m/z: 293,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,07 (с, 2H); 8,91 (с, 1H); 8,28 (с, 1H); 7,75 (тд, J=9,5, 4,2 Гц, 1H); 7,28 (тд, J=10,4, 3,6 Гц, 1H).

Пример 117: 1-(4-оксо-8-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 2-трифторметоксифениламина. МС (ИЭР/ХИ): рассчитано для C13H7F3N4O 4: 340,1; получено m/z: 341,1 [M+H]+. 1 H ЯМР (500 МГц, DMSO-d6): 13,12 (с, 2H); 8,84 (д, J=0,6 Гц, 1H); 8,30 (д, J=0,6 Гц, 1H); 8,16 (дд, J=8,0, 1,4 Гц, 1H); 7,95-7,84 (м, 1H); 7,58 (т, J=8,0 Гц, 1H).

Пример 118: 1-(8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 2-фторфениламина. МС (ИЭР/ХИ): рассчитано для C 12H7FN4O3: 274,0; получено m/z: 275,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,05 (с, 2H); 8,92 (с, 1H); 8,28 (с, 1H); 7,96 (д, J=7,6 Гц, 1H); 7,75-7,73 (м, 1H); 7,51 (тд, J=8,0, 4,7 Гц, 1H).

Пример 119: 1-(6-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-изопропилфениламина. МС (ИЭР/ХИ): рассчитано для C15H14N4O3: 298,1; получено m/z: 299,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 12,90 (с, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,97 (д, J=1,7 Гц, 1H); 7,77 (дд, J=8,4, 2,0 Гц, 1H); 7,65 (д, J=7,8 Гц, 1H); 3,1-3,04 (м, 1H); 1,27 (д, J=6,9 Гц, 6H).

Пример 120: 1-(6-втор-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-втор-бутилфениламина. МС (ИЭР/ХИ): рассчитано для C16H16N4O3: 312,1; получено m/z: 313,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,91 (с, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,93 (с, 1H); 7,72 (дд, J=8,4, 1,8 Гц, 1H); 7,65 (д, J=8,3 Гц, 1H); 2,82-2,77 (м, 1H); 1,76-1,50 (м, 2H); 1,26 (д, J=6,9 Гц, 3H); 0,79 (т, J=7,3 Гц, 3H).

Пример 121: 1-(6-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-этоксифениламина. МС (ИЭР/ХИ): рассчитано для C 14H12N4O4: 300,1; получено m/z: 301,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 12,96 (с, 1H); 12,79 (с, 1H); 8,92 (с, 1H); 8,23 (с, 1H); 7,64 (д, J=7,8 Гц, 1H); 7,51 (д, J=2,3 Гц, 1H); 7,45 (дд, J=8,8, 2,8 Гц, 1H); 4,16 (кв, J=6,9 Гц, 2H); 1,38 (т, J=6,9 Гц, 3H).

Пример 122: 1-(6-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-метоксифениламина. МС (ИЭР/ХИ): рассчитано для C13H10N4O4: 286,1; получено m/z: 287,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,95 (с, 2H); 8,92 (с, 1H); 8,24 (с, 1H); 7,65 (д, J=7,7 Гц, 1H); 7,53 (д, J=2,6 Гц, 1H); 7,46 (дд, J=8,9, 2,9 Гц, 1H); 3,89 (с, 3H).

Пример 123: 1-(4-оксо-6-пирролидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-пирролидин-1-илфениламина. МС (ИЭР/ХИ): рассчитано для C16H15N5O3: 325,1; получено m/z: 326,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 12,91 (с, 1H); 12,44 (с, 1H); 8,87 (д, J=0,6 Гц, 1H); 8,20 (с, 1H); 7,55 (д, J=8,9 Гц, 1H); 7,15 (дд, J=9,0, 2,9 Гц, 1H); 7,04 (д, J=2,8 Гц, 1H); 3,34 (т, J=6,4 Гц, 4H); 2,00 (т, J=6,5 Гц, 4H).

Пример 124: 1-(4-оксо-6-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-пиперидин-1-илфениламина. МС (ИЭР/ХИ): рассчитано для C17H17N5O3: 339,1; получено m/z: 340,2 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 8,92 (с, 1H); 8,24 (с, 1H); 7,79 (уш с, 2H); 7,67 (с, 1H); 4,31 (уш с, 4H); 1,76 (с, 4 H); 1,62 (с, 2H).

Пример 125: 1-(6-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А N,N-диметилбензол-1,4-диамина. МС (ИЭР/ХИ): рассчитано для C14H13N5O3: 299,1; получено m/z: 300,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,94 (с, 1H); 12,55 (с, 1H); 8,88 (д, J=0,5 Гц, 1H); 8,20 (с, 1H); 7,56 (д, J=9,0 Гц, 1H); 7,36 (дд, J=9,1, 3,0 Гц, 1H); 7,21 (д, J=2,8 Гц, 1H); 3,03 (с, 6H).

Пример 126: 1-(4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А фениламина. МС (ИЭР/ХИ): рассчитано для C12 H8N4O3: 256,1; получено m/z: 257,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,00 (с, 2H); 8,96 (с, 1H); 8,27 (с, 1H); 8,14 (д, J=7,6 Гц, 1H); 7,89-7,83 (м, 1H); 7,71 (д, J=7,7 Гц, 1H); 7,52 (дд, J=11,5, 4,5 Гц, 1H).

Пример 127: 1-(6-бром-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-бром-3-фторфениламина. МС (ИЭР/ХИ): рассчитано для C12H6BrFN4O3: 352,0; получено m/z: 353,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,08 (с, 2H); 8,93 (с, 1H); 8,35 (д, J=7,6 Гц, 1H); 8,29 (с, 1H); 7,69 (д, J=9,6 Гц, 1H).

Пример 128: 1-(6-этил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-этилфениламина. МС (ИЭР/ХИ): рассчитано для C 14H12N4O3: 284,1; получено m/z: 285,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,89 (уш с, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,96 (с, 1H); 7,72 (д, J=7,0 Гц, 1H); 7,64 (с, 1H); 2,77 (кв, J=7,5 Гц, 2H); 1,25 (т, J=7,6 Гц, 3H).

Пример 129: 1-(4-оксо-6-пропил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-пропилфениламина. МС (ИЭР/ХИ): рассчитано для C 15H14N4O3: 298,1; получено m/z: 299,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,97 (с, 2H); 8,94 (с, 1H); 8,26 (с, 1H); 7,93 (с, 1H); 7,70 (дд, J=8,3, 1,9 Гц, 1H); 7,63 (д, J=7,9 Гц, 1H); 2,71 (т, J=7,5 Гц, 2H); 1,70-1,61 (м, 2H); 0,91 (т, J=7,3 Гц, 3H).

Пример 130: 1-(6-бром-8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 109 (стадии А, В и F), с использованием на стадии А 4-бром-2-фторфениламина. МС (ИЭР/ХИ): рассчитано для C12H6BrFN4O3: 352,0; получено m/z: 353,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,30 (с, 1H); 13,08 (с, 1H); 8,91 (с, 1H); 8,29 (с, 1H); 8,08 (дд, J=9,7, 2,2 Гц, 1H); 8,04 (дд, J=2,1, 1,0 Гц, 1H).

Пример 131: 1-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[(3,5-дифторфенилимино)-этоксикарбониламинометил]-1H-пиразол-4-карбоновой кислоты. К раствору 3,5-дифторанилина (0,680 г, 5,27 ммоль) в DCM (26 мл) добавили этилизотиоцианатформат (0,68 мл, 5,8 ммоль). Через 3 ч в реакционную смесь добавили триэтиламин (2,20 мл, 15,8 ммоль), затем этилпиразол-4-карбоксилат (0,812 г, 5,79 ммоль) и EDCI (1,21 г, 6,32 ммоль). Через 1,5 ч реакционную смесь разбавили DCM (25 мл), промыли водой (3 x 30 мл) и насыщенным солевым рассолом (50 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 3-45%) и получили искомое соединение (0,323 г, выход 17%). МС (ИЭР/ХИ): рассчитано для C16H16F2N4O4 : 366,1; получено m/z: 367,1 [M+H]+.

Стадия B. Получение этилового эфира 1-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[(3,5-дифторфенилимино)-этоксикарбониламинометил]-1H-пиразол-4-карбоновой кислоты (0,321 г, 0,876 ммоль) в DCE (2,7 мл) осторожно добавили хлорид титана (IV) (0,39 мл, 3,5 ммоль) и выдержали полученный раствор при 110°C в течение 1,5 ч. Затем реакционную смесь охладили до комнатной температуры и добавили воду (50 мл), метанол (1 мл) и DCM (40 мл). Полученную двухфазную смесь перемешивали в течение 30 мин, и затем разделили фазы. Водную фазу экстрагировали далее DCM (2x30 мл). Объединенные органические фазы промыли насыщенным солевым раствором (40 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток растерли из EtOH и получили искомое соединение (0,172 г, выход 60%). МС (ИЭР/ХИ): рассчитано для C14 H10F2N4O3: 320,1; получено m/z: 321,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,09 (с, 1H); 8,99 (д, J=0,5 Гц, 1H); 8,35 (с, 1H); 7,42-7,32 (м, 2H); 4,30 (кв, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия C. Получение 1-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,152 г, 0,475 ммоль) в THF (1,7 мл) добавили 1 M водного раствора гидроксида калия (1,7 мл, 1,7 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем сконцентрировали. Полученный остаток повторно растворили в воде (5 мл) и довели до pH 1 при помощи 1 М водного раствора HCl. Выпавший осадок собрали фильтрованием и получили искомое соединение (0,137 г, выход 98%). МС (ИЭР/ХИ): рассчитано для C12 H6F2N4O3: 292,0; получено m/z: 293,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,07 (с, 2H); 8,93 (д, J=0,4 Гц, 1H); 8,28 (с, 1H); 7,44 - 7,27 (м, 2H).

Пример 132: 1-(5,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3,5-дихлоранилина. МС (ИЭР/ХИ): рассчитано для C12 H6Cl2N4O3: 324,0; получено m/z: 325,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,08 (с, 2H); 8,93 (с, 1H); 8,28 (с, 1H); 7,70 (с, 1H); 7,65 (д, J=2,0 Гц, 1H).

Пример 133: 1-(7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3-фторанилина. МС (ИЭР/ХИ): рассчитано для C12H 7FN4O3: 274,1; получено m/z: 275,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6 ): 13,04 (с, 2H); 8,94 (с, 1H); 8,28 (с, 1H); 8,19 (дд, J=8,7, 6,4 Гц, 1H); 7,49 (д, J=9,1 Гц, 1H); 7,38 (тд, J=8,7, 2,5 Гц, 1H).

Пример 134: 1-(7-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3-броманилина. МС (ИЭР/ХИ): рассчитано для C12H 7BrN4O3: 334,0; получено m/z: 335,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6 ): 13,05 (с, 2H); 8,94 (д, J=0,5 Гц, 1H); 8,28 (с, 1H); 8,03 (д, J=8,5 Гц, 1H); 7,90 (с, 1H); 7,68 (дд, J=8,5, 1,9 Гц, 1H).

Пример 135: 1-(7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3-метоксианилина. МС (ИЭР/ХИ): рассчитано для C13 H10N4O4: 286,1; получено m/z: 287,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,01 (с, 1H); 12,68 (с, 1H); 8,94 (с, 1H); 8,25 (с, 1H); 8,04 (д, J=8,8 Гц, 1H); 7,14 (с, 1H); 7,10 (дд, J=8,8, 2,2 Гц, 1H); 3,91 (с, 3H).

Пример 136: 1-(7-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3-бензиланилина. МС (ИЭР/ХИ): рассчитано для C19 H14N4O3: 346,1; получено m/z: 347,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,00 (с, 1H); 12,75 (с, 1H); 8,93 (с, 1H); 8,25 (с, 1H); 8,05 (д, J=8,0 Гц, 1H); 7,52 (с, 1H); 7,41 (д, J=8,4 Гц, 1H); 7,36-7,26 (м, 4H); 7,26-7,18 (м, 1H); 4,12 (с, 2H).

Пример 137: 1-(4-оксо-3,4,8,9-тетрагидро-7H-6,10-диокса-1,3-диазациклогепта[b]нафталин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3,4-дигидро-2H-бензо[b][1,4]диоксепин-7-иламина. Искомое соединение выделили в виде калиевой соли путем растирания остатка со стадии C с этанолом и концентрирования реакционной смеси. МС (ИЭР/ХИ): рассчитано для C15H12N4O 5: 328,1; получено m/z: 329,1 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 8,41 (д, J=0,8 Гц, 1H); 7,54 (д, J=0,8 Гц, 1H); 7,44 (с, 1H); 6,93 (с, 1H); 4,19-4,13 (м, 2H); 4,10 (т, J=5,4 Гц, 2H); 2,17-2,03 (м, 2H).

Пример 138: 1-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[(2,3-дигидробензо[1,4]диоксин-5-илимино)-этоксикарбониламинометил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадия А, с использованием 2,3-дигидробензо[1,4]диоксин-5-иламина. МС (ИЭР/ХИ): рассчитано для C18H20N 4O6: 388,1; получено m/z: 389,2 [M+H]+ .

Стадия B. Получение этилового эфира 1-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[(2,3-дигидробензо[1,4]диоксин-5-илимино)-этоксикарбониламинометил]-1H-пиразол-4-карбоновой кислоты (1,39 г, 3,58 ммоль) в DCE (11 мл) осторожно добавили хлорид титана (IV) (1,2 мл, 11 ммоль) и выдержали полученный раствор при 110°C в течение 2 ч. Затем реакционную смесь охладили до комнатной температуры и добавили этанол (60 мл). Полученную суспензию перемешали при комнатной температуре в течение 30 мин; затем выпавший осадок собрали, получив искомое соединение (0,970 г, выход 78%). МС (ИЭР/ХИ): рассчитано для C16 H14N4O5: 342,1; получено m/z: 343,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,78 (с, 1H); 8,90 (д, J=0,5 Гц, 1H); 8,31 (с, 1H); 7,62 (д, J=8,7 Гц, 1H); 7,06 (д, J=8,8 Гц, 1H); 4,48-4,35 (м, 4H); 4,30 (кв, J=7,1 Гц, 2H); 1,33 (т, J=7,1 Гц, 3H).

Стадия C. Получение 1-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновой кислоты (0,298 г, 0,869 ммоль) в THF (2,6 мл) добавили 1 М водного раствора гидроксида калия (2,6 мл, 2,6 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 2 суток и затем сконцентрировали. Полученный остаток повторно растворили в воде (10 мл) и довели до pH 1 при помощи 1 М водного раствора HCl. Выпавший осадок собрали фильтрованием и получили искомое соединение (0,235 г, выход 85%). МС (ИЭР/ХИ): рассчитано для C14 H10N4O5: 314,1; получено m/z: 315,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,01 (с, 1H); 12,73 (с, 1H); 8,86 (д, J=0,7 Гц, 1H); 8,24 (д, J=0,6 Гц, 1H); 7,61 (д, J=8,8 Гц, 1H); 7,05 (д, J=8,7 Гц, 1H); 4,40 (с, 4H).

Пример 139: 1-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А 2,3-дигидробензо[1,4]диоксин-6-иламина. На стадии B в качестве растворителя вместо DCE использовали толуол и очистили полученный продукт КФХ (DCM/MeOH 0-10%). МС (ИЭР/ХИ): рассчитано для C16H14N4O 5: 342,1; получено m/z: 343,1 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,69 (с, 1H); 8,95 (д, J=0,6 Гц, 1H); 8,27 (с, 1H); 7,48 (с, 1H); 7,13 (с, 1H); 4,42-4,33 (м, 4H); 4,29 (кв, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (78,0 мг, 0,228 ммоль) в THF (0,85 мл) добавили моногидрат гидроксида лития (28,7 мг, 0,684 ммоль) и воду (0,29 мл). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч, затем сконцентрировали и полученный остаток повторно растворили в воде (5 мл). Полученный раствор доводили до pH 1 при помощи 1 М водного раствора HCl. Выпавший осадок собрали и высушили, получив искомое соединение (54,3 мг, выход 75%). МС (ИЭР/ХИ): рассчитано для C14H10N4O 5: 314,1; получено m/z: 315,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,97 (с, 1H); 12,61 (с, 1H); 8,89 (д, J=0,6 Гц, 1H); 8,23 (с, 1H); 7,48 (с, 1H); 7,14 (с, 1H); 4,46-4,29 (м, 4H).

Пример 140: 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А индан-5-иламина. На стадии B получили смесь искомого соединения и этилового эфира 1-(1-оксо-2,7,8,9-тетрагидро-1H-циклопента[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 10:1.

Данные для этилового эфира 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты: МС (ИЭР/ХИ): рассчитано для C17H16 N4O3: 324,1; получено m/z: 325,1 [M+H] +. 1H ЯМР (400 МГц, DMSO-d6): 12,72 (с, 1H); 8,98 (д, J=0,6 Гц, 1H); 8,30 (с, 1H); 7,95 (с, 1H); 7,52 (с, 1H); 4,30 (кв, J=7,1 Гц, 2H); 3,01 (т, J=7,3 Гц, 2H); 2,98 (т, J=7,3 Гц, 2H); 2,09 (квинт, J=7,5 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты и этилового эфира 1-(1-оксо-2,7,8,9-тетрагидро-1H-циклопента[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 10:1 (1,18 г, 0,228 ммоль) в THF (13,6 мл) добавили моногидрат гидроксида лития (0,611 г, 14,6 ммоль) и воду (9,1 мл) и перемешивали реакционную смесь при комнатной температуре в течение 18 ч. Затем реакционную смесь сконцентрировали и полученный остаток повторно растворили в воде (20 мл). Полученный раствор довели до pH 1 при помощи 1 М водного раствора HCl. Выпавший осадок собрали и высушили, получив смесь искомого соединения и 1-(1-оксо-2,7,8,9-тетрагидро-1H-циклопента[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 10:1 (1,05 г, выход 98%). Часть собранного осадка (0,511 г) дважды растерли из 10 мл DMSO, получив чистый образец искомого соединения (0,310 г, выход 61%). МС (ИЭР/ХИ): рассчитано для C15H12N4O 3: 296,1; получено m/z: 297,1 [M+H]+. 1 H ЯМР (600 МГц, DMSO-d6): 13,00 (с, 1H); 12,68 (с, 1H); 8,93 (с, 1H); 8,24 (с, 1H); 7,96 (с, 1H); 7,52 (с, 1H); 3,05-2,93 (м, 4H); 2,09 (квинт, J=7,4 Гц, 2H).

Стадия C. Получение 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты, калиевой соли. К раствору 1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,250 г, 0,844 ммоль) в метаноле (4,2 мл) добавили карбонат калия (58,3 мг, 0,422 ммоль) и кипятили полученную смесь с обратным холодильником в течение 3 ч. Затем температуру снизили до 60°C и продолжали перемешивание еще 18 ч. Затем реакционную смесь охладили до комнатной температуры, выпавший осадок отфильтровали и высушили, получив калиевую соль искомого соединения (0,204 г, выход 71%). МС (ИЭР/ХИ): рассчитано для C15H 12N4O3: 296,1; получено m/z: 297,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6 ): 12,63 (с, 1H); 8,81 (с, 1H); 7,92 (с, 1H); 7,80 (с, 1H); 7,29 (с, 1H); 2,96-2,89 (м, 4H); 2,04 (квинт, J=7,4 Гц, 2H).

Пример 141: 1-(6-оксо-2,3,6,7-тетрагидро-1H-7,9-диазациклопента[a]нафталин-8-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 138, с использованием индан-4-иламина на стадии A и гашением реакционной смеси раствором этанол/вода в соотношении 50:1 вместо чистого этанола на стадии В. МС (ИЭР/ХИ): рассчитано для C15H12N4O 3: 296,1; получено m/z: 297,1 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,02 (с, 1H); 12,66 (с, 1H); 8,96 (д, J=0,7 Гц, 1H); 8,25 (д, J=0,6 Гц, 1H); 7,93 (д, J=7,9 Гц, 1H); 7,38 (д, J=8,0 Гц, 1H); 3,16 (т, J=7,5 Гц, 2H); 3,04 (т, J=7,5 Гц, 2H); 2,14 (квинт, J=7,6 Гц, 2H).

Пример 142: 1-(4-оксо-3,4,7,8,9,10-гексагидробензо[h]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием 5,6,7,8-тетрагидронафталин-1-иламина на стадии A и выделением искомого соединения в виде калиевой соли путем растирания полученного на стадии C остатка с этанолом и концентрирования реакционной смеси. МС (ИЭР/ХИ): рассчитано для C16H14N4O3: 310,1; получено m/z: 311,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 8,50 (д, J=0,8 Гц, 1H); 7,66 (д, J=8,1 Гц, 1H); 7,55 (д, J=0,8 Гц, 1H); 6,78 (д, J=8,1 Гц, 1H); 2,97 (т, J=5,8 Гц, 2H); 2,75 (т, J=5,8 Гц, 2H); 1,89-1,68 (м, 4H).

Пример 143: 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А 5,6,7,8-тетрагидронафталин-2-иламина. На стадии B получили смесь искомого соединения и этилового эфира 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 2:1.

Данные для этилового эфира 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты: МС (ИЭР/ХИ): рассчитано для C18H18 N4O3: 338,1; получено m/z: 339,1 [M+H] +. 1H ЯМР (400 МГц, DMSO-d6): 12,66 (с, 1H); 8,98 (с, 1H); 8,30 (с, 1H); 7,84 (с, 1H); 7,40 (с, 1H); 4,30 (кв, J=7,1 Гц, 2H); 2,97-2,77 (м, 4H); 1,87-1,68 (м, 4H); 1,33 (т, J=7,1 Гц, 3H).

Стадия B. Получение этилового эфира 1-[3-(2-метоксиэтоксиметил)-4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты и этилового эфира 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 2:1 (0,500 г, 1,478 ммоль) в THF (7,4 мл) добавили DIEA (0,76 мл, 4,4 ммоль) и затем 1-хлорметокси-2-метоксиэтан (0,186 мл, 1,63 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч, затем разбавили EtOAc (40 мл) и промыли водой (30 мл). Полученную водную фазу экстрагировали EtOAc (2 x 30 мл), объединенные органические фазы промыли насыщенным солевым раствором (40 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 5-60%) и получили искомое соединение (0,257 г, выход 41%) и этиловый эфир 1-[2-(2-метоксиэтоксиметил)-1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил]-1H-пиразол-4-карбоновой кислоты (69,0 мг, выход 11%).

Данные для этилового эфира 1-[3-(2-метоксиэтоксиметил)-4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты: 1H ЯМР (500 МГц, CDCl3): 8,60 (с, 1H); 8,14 (с, 1H); 8,02 (с, 1H); 7,39 (с, 1H); 5,90 (с, 2H); 4,35 (кв, J=7,1 Гц, 2H); 3,63-3,57 (м, 2H); 3,37-3,31 (м, 2H); 3,20 (с, 3H); 2,93 (с, 4H); 1,86 (т, J=3,2 Гц, 4H); 1,38 (т, J=7,1 Гц, 3H).

Стадия C. Получение этилового эфира 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[3-(2-метоксиэтоксиметил)-4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,254 г, 0,596 ммоль) в этаноле (2,0 мл) добавили раствор HCl (4 M в диоксане, 2,1 мл, 8,3 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 4 ч, затем добавили диэтиловый эфир (2 мл) и собрали выпавший осадок. Осадок трижды растерли с этанолом, один раз со смесью этанол/THF (1:1) и один раз с DMSO. Отфильтрованный осадок промыли этанолом и высушили, получив искомое соединение (89,4 мг, выход 44%). МС (ИЭР/ХИ): рассчитано для C18H18N4O3: 338,1; получено m/z: 339,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 12,66 (с, 1H); 8,98 (с, 1H); 8,30 (с, 1H); 7,84 (с, 1H); 7,40 (с, 1H); 4,30 (кв, J=7,1 Гц, 2H); 2,95-2,83 (м, 4H); 1,82-1,74 (м, 4H); 1,32 (т, J=7,1 Гц, 3H).

Стадия D. Получение 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (87,5 мг, 0,259 ммоль) в THF (0,55 мл) добавили моногидрат гидроксида лития (25,5 мг, 0,608 ммоль) и воду (0,45 мл). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем сконцентрировали. Полученный остаток повторно растворили в воде (5 мл) и довели полученный раствор до pH 1 при помощи 1 М водного раствора HCl. Выпавший осадок собрали и высушили, получив искомое соединение (76,6 мг, выход 95%). МС (ИЭР/ХИ): рассчитано для C16H14N4O 3: 310,1; получено m/z: 311,1 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,00 (с, 1H); 12,61 (с, 1H); 8,91 (с, 1H); 8,24 (с, 1H); 7,83 (с, 1H); 7,40 (с, 1H); 2,89 (уш д, J=4,7 Гц, 4H); 1,84-1,72 (м, 4H).

Пример 144: 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(1-оксо-1,2,7,8,9,10-гексагидро-бензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А 5,6,7,8-тетрагидронафталин-2-иламина. На стадии B получили смесь этилового эфира 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты и искомого соединения в соотношении 2:1.

Данные для этилового эфира 1-(1-оксо-1,2,7,8,9,10-гексагидро-бензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты: МС (ИЭР/ХИ): рассчитано для C18H18 N4O3: 338,1; получено m/z: 339,1 [M+H] +. 1H ЯМР (400 МГц, DMSO-d6): 12,49 (с, 1H); 8,99 (с, 1H); 8,30 (с, 1H); 7,84 (д, J=8,2 Гц, 1H); 7,45-7,38 (м, 1H); 4,30 (кв, J=7,1 Гц, 2H); 3,46-3,25 (м, 2H); 2,97-2,77 (м, 2H); 1,87-1,68 (м, 4H); 1,33 (т, J=7,1 Гц, 3H).

Стадия B. Получение этилового эфира 1-[2-(2-метоксиэтоксиметил)-1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил]-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты и этилового эфира 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 2:1 (0,500 г, 1,478 ммоль) в THF (7,4 мл) добавили DIEA (0,76 мл, 4,4 ммоль) и затем 1-хлорметокси-2-метоксиэтан (0,186 мл, 1,63 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч, затем разбавили EtOAc (40 мл) и промыли водой (30 мл). Полученную водную фазу экстрагировали EtOAc (2 x 30 мл), объединенные органические фазы промыли насыщенным солевым раствором (40 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 5-60%) и получили этиловый эфир 1-[3-(2-метоксиэтоксиметил)-4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,257 г, выход 41%) и искомое соединение (69,0 мг, выход 11%).

Данные для этилового эфира 1-[2-(2-метоксиэтоксиметил)-1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил]-1H-пиразол-4-карбоновой кислоты: 1H ЯМР (500 МГц, CDCl3): 8,62 (с, 1H); 8,14 (с, 1H); 7,47 (д, J=8,4 Гц, 1H); 7,42 (д, J=8,3 Гц, 1H); 5,84 (с, 2H); 4,35 (кв, J=7,2 Гц, 2H); 3,64-3,58 (м, 2H); 3,47 (т, J=6,1 Гц, 2H); 3,41-3,34 (м, 2H); 3,23 (с, 3H); 2,89 (т, J=6,1 Гц, 2H); 1,91-1,78 (м, 4H); 1,38 (т, J=7,1 Гц, 3H).

Стадия C. Получение этилового эфира 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[2-(2-метоксиэтоксиметил)-1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил]-1H-пиразол-4-карбоновой кислоты (70,0 мг, 0,164 ммоль) в этаноле (0,57 мл) добавили 4 M раствора HCl в диоксане (0,57 мл, 2,3 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 4 ч, затем добавили эфир (2 мл) и собрали выпавший осадок, получив искомое соединение (27,0 мг, выход 49%). МС (ИЭР/ХИ): рассчитано для C18 H18N4O3: 338,1; получено m/z: 339,1 [M+H]+.

Стадия D. Получение 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты. К этиловому эфиру 1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты (25,0 мг, 73,9 мкмоль) в THF (0,28 мл) добавили моногидрат гидроксида лития (9,3 мг, 0,22 ммоль) и воду (0,19 мл). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем сконцентрировали. Полученный остаток повторно растворили в воде (3 мл) и полученный раствор довели до pH 1 при помощи 1 М водного раствора HCl. Выпавший осадок собрали и высушили, получив искомое соединение (19,6 мг, выход 85%). МС (ИЭР/ХИ): рассчитано для C16H14N4O 3: 310,1; получено m/z: 311,1 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,98 (с, 1H); 12,42 (с, 1H); 8,92 (с, 1H); 8,23 (с, 1H); 7,51 (д, J=8,5 Гц, 1H); 7,41 (д, J=8,3 Гц, 1H); 3,37 (т, J=5,8 Гц, 2H); 2,83 (т, J=5,3 Гц, 2H); 1,84-1,67 (м, 4H).

Пример 145: 1-(5,7-диметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 138, с использованием на стадии А 3,5-диметиланилина. На стадии В вместо прибавления к реакционной смеси этанола реакционную смесь осторожно добавили в этанол по каплям при помощи пипетки. МС (ИЭР/ХИ): рассчитано для C 14H12N4O3: 284,1; получено m/z: 285,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,99 (с, 1H); 12,39 (с, 1H); 8,89 (д, J=0,5 Гц, 1H); 8,24 (с, 1H); 7,30 (с, 1H); 7,09 (с, 1H); 2,73 (с, 3H); 2,39 (с, 3H).

Пример 146: 1-(7-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 138, с использованием на стадии А 3-изопропиланилина. На стадии В вместо прибавления к реакционной смеси этанола реакционную смесь осторожно добавили в этанол по каплям при помощи пипетки. МС (ИЭР/ХИ): рассчитано для C 15H14N4O3: 298,1; получено m/z: 299,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,01 (с, 1H); 12,74 (с, 1H); 8,94 (с, 1H); 8,26 (с, 1H); 8,06 (д, J=8,1 Гц, 1H); 7,54 (с, 1H); 7,44 (д, J=8,2 Гц, 1H); 3,13-3,00 (м, 1H); 1,28 (д, J=6,9 Гц, 6H).

Пример 147: 1-(7-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 138, с использованием на стадии А 3-трет-бутиланилина. На стадии В вместо прибавления к реакционной смеси этанола реакционную смесь осторожно добавили в этанол по каплям при помощи пипетки. МС (ИЭР/ХИ): рассчитано для C 16H16N4O3: 312,1; получено m/z: 313,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,00 (с, 1H); 12,75 (с, 1H); 8,97 (с, 1H); 8,26 (с, 1H); 8,07 (д, J=8,3 Гц, 1H); 7,69-7,56 (м, 2H); 1,36 (с, 9H).

Пример 148: 1-(4-оксо-7-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 138, с использованием на стадии А 3-трифторметоксианилина. На стадии В вместо прибавления к реакционной смеси этанола реакционную смесь осторожно добавили в этанол по каплям при помощи пипетки. МС (ИЭР/ХИ): рассчитано для C 13H7F3N4O4: 340,0; получено m/z: 341,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,06 (с, 2H); 8,97 (с, 1H); 8,29 (с, 1H); 8,25 (д, J=8,8 Гц, 1H); 7,63 (с, 1H); 7,49 (д, J=8,8 Гц, 1H).

Пример 149: 1-(7-изопропокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием 3-изопропиланилина на стадии А и исключением очистки путем обращенно-фазовой ВЭЖХ на стадии В. МС (ИЭР/ХИ): рассчитано для C15H 14N4O4: 314,1; получено m/z: 315,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6 ): 12,99 (с, 1H); 12,61 (с, 1H); 8,94 (с, 1H); 8,25 (с, 1H); 8,02 (д, J=8,6 Гц, 1H); 7,11 (с, 1H); 7,05 (дд, J=8,8, 2,1 Гц, 1H); 4,83 (уш с, 1H); 1,34 (д, J=6,0 Гц, 6H).

Пример 150: 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А 3-(N,N-диметил)анилина. На стадии B получили смесь искомого соединения и этилового эфира 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 3:2.

Данные для этилового эфира 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты: МС (ИЭР/ХИ): рассчитано для C16H17 N5O3: 327,1; получено m/z: 328,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 12,22 (с, 1H); 8,98 (с, 1H); 8,28 (с, 1H); 7,90 (д, J=8,9 Гц, 1H); 6,93 (дд, J=8,9, 2,1 Гц, 1H); 6,73 (с, 1H); 4,29 (кв, J=7,1 Гц, 2H); 3,07 (с, 6H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты и этилового эфира 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 3:2 (0,415 г, 1,27 ммоль) в THF (3,8 мл) добавили 1 М водного раствора KOH (3,8 мл, 3,8 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем сконцентрировали. Остаток повторно растворили в воде (10 мл) и подкислили 1 М водного раствора HCl (3 мл). Выпавший осадок собрали фильтрованием и получили смесь искомого соединения и 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Собранный осадок растерли из DMSO и промыли этанолом, получив чистую 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновую кислоту (0,113 мг, выход 29%). Фильтрат сохранили для дальнейшей очистки. МС (ИЭР/ХИ): рассчитано для C14H13 N5O3: 299,1; получено m/z: 300,1 [M+H] +. 1H ЯМР (400 МГц, DMSO-d6): 12,97 (с, 1H); 12,21 (с, 1H); 8,92 (с, 1H); 8,22 (с, 1H); 7,90 (д, J=8,9 Гц, 1H); 6,93 (дд, J=9,0, 2,3 Гц, 1H); 6,72 (с, 1H); 3,07 (с, 6H).

Пример 151: 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А 3-(N,N-диметил)анилина. На стадии B получили смесь этилового эфира 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты и искомого соединения в соотношении 3:2.

Данные для этилового эфира 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты: МС (ИЭР/ХИ): рассчитано для C16H17 N5O3: 327,1; получено m/z: 328,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 12,22 (с, 1H); 8,98 (с, 1H); 8,20 (с, 1H); 8,01-7,39 (уш м, 3H); 4,29 (кв, J=7,1 Гц, 2H); 3,31 (с, 6H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты и этилового эфира 1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты в соотношении 3:2 (0,415 г, 1,27 ммоль) в THF (3,8 мл) добавили 1 М водного раствора KOH (3,8 мл, 3,8 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем сконцентрировали. Полученный остаток повторно растворили в воде (10 мл) и подкислили водным раствором HCl (1 M, 3 мл). Выпавший осадок собрали фильтрованием и получили смесь искомого соединения и 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Собранный осадок растерли из DMSO и промыли этанолом, получив чистую 1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновую кислоту. Собранный после растирания фильтрат очистили путем обращенно-фазовой ВЭЖХ с получением искомого соединения (49,7 мг, выход 13%). МС (ИЭР/ХИ): рассчитано для C14H13N5 O3: 299,1; получено m/z: 300,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,99 (с, 2H); 8,96 (д, J=0,6 Гц, 1H); 8,25 (с, 1H); 7,84 (т, J=8,1 Гц, 1H); 7,67-7,48 (м, 2H); 3,12 (с, 6H).

Пример 152: 1-(7-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 138, с использованием на стадии А 3-этоксианилина. На стадии В вместо прибавления к реакционной смеси этанола реакционную смесь осторожно добавили в этанол по каплям при помощи пипетки. МС (ИЭР/ХИ): рассчитано для C 14H12N4O4: 300,1; получено m/z: 301,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,01 (с, 1H); 12,66 (с, 1H); 8,93 (с, 1H); 8,25 (с, 1H); 8,02 (д, J=8,7 Гц, 1H); 7,21-7,02 (м, 2H); 4,19 (кв, J=6,8 Гц, 2H); 1,39 (т, J=7,0 Гц, 3H).

Пример 153: 1-(6-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 138, с использованием на стадии А 4-хлоранилина. На стадии В вместо прибавления к реакционной смеси этанола реакционную смесь осторожно добавили в этанол по каплям при помощи пипетки. МС (ИЭР/ХИ): рассчитано для C 12H7ClN4O3: 290,0; получено m/z: 291,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,05 (с, 2H); 8,95 (с, 1H); 8,28 (с, 1H); 8,06 (д, J=2,3 Гц, 1H); 7,88 (дд, J=8,7, 2,5 Гц, 1H); 7,72 (д, J=7,8 Гц, 1H).

Пример 154: 1-(7-гидрокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3-изопропиланилина. На стадии B образовавшийся продукт (этиловый эфир 1-(7-гидрокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты) собрали фильтрованием из фаз вода/DCM. МС (ИЭР/ХИ): рассчитано для C12H8N4O 4: 272,1; получено m/z: 273,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,94 (с, 2H); 10,66 (с, 1H); 8,94 (с, 1H); 8,24 (с, 1H); 7,97 (д, J=8,8 Гц, 1H); 7,09-6,85 (м, 2H).

Пример 155: 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А 4-метилсульфаниланилина. МС (ИЭР/ХИ): рассчитано для C15H14N 4O3S: 330,1; получено m/z: 331,1 [M+H]+ . 1H ЯМР (400 МГц, DMSO-d6): 12,95 (с, 1H); 9,00 (с, 1H); 8,31 (с, 1H); 7,86 (д, J=1,9 Гц, 1H); 7,74 (дд, J=8,6, 2,2 Гц, 1H); 7,64 (д, J=7,4 Гц, 1H); 4,30 (кв, J=7,1 Гц, 2H); 2,59 (с, 3H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадия С, с использованием этилового эфира 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. МС (ИЭР/ХИ): рассчитано для C13H10 N4O3S: 302,1; получено m/z: 303,1 [M+H] +. 1H ЯМР (400 МГц, DMSO-d6): 13,13-12,78 (м, 2H); 8,94 (с, 1H); 8,25 (с, 1H); 7,86 (с, 1H); 7,74 (дд, J=8,6, 2,3 Гц, 1H); 7,63 (д, J=8,3 Гц, 1H); 2,59 (с, 3H).

Пример 156: 1-(4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 4-трифторметилсульфаниланилина. МС (ИЭР/ХИ): рассчитано для C13H7F3N4O3 S: 356,0; получено m/z: 357,0 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 13,20 (с, 1H); 13,08 (с, 1H); 8,98 (с, 1H); 8,36 (с, 1H); 8,31 (с, 1H); 8,10 (дд, J=8,5, 2,2 Гц, 1H); 7,82 (уш с, 1H).

Пример 157: 1-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 155, продукт стадии A) (64,0 мг, 0,194 ммоль) в DCM (1,0 мл) добавили 3-хлорпероксибензойную кислоту (91,2 мг, 0,407 ммоль). Реакционную смесь перемешивали в течение 18 ч и затем концентрировали. Остаток растерли из этанола и получили искомое соединение (63,0 мг, выход 90%). Фильтрат погасили 0,5 M водного раствора тиосульфата натрия. МС (ИЭР/ХИ): рассчитано для C15H14N4O 5S: 362,1; получено m/z: 363,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,39 (с, 1H); 9,07 (д, J=0,5 Гц, 1H); 8,57 (д, J=2,1 Гц, 1H); 8,38 (с, 1H); 8,30 (дд, J=8,6, 2,3 Гц, 1H); 7,91 (д, J=8,3 Гц, 1H); 4,31 (кв, J=7,1 Гц, 2H); 3,33 (с, 3H); 1,33 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадия С, с использованием этилового эфира 1-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. МС (ИЭР/ХИ): рассчитано для C13H10 N4O5S: 334,0; получено m/z: 335,0 [M+H] +; 333,1, [M-H]-. 1H ЯМР (400 МГц, DMSO-d6): 13,35 (с, 1H); 13,09 (с, 1H); 9,01 (с, 1H); 8,57 (д, J=2,1 Гц, 1H); 8,32 (с, 1H); 8,29 (дд, J=8,6, 2,2 Гц, 1H); 7,90 (д, J=7,5 Гц, 1H); 3,33 (с, 3H).

Пример 158: 1-(7-хлор-6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 131, с использованием на стадии А 3-хлор-4-метилсульфаниланилина. МС (ИЭР/ХИ): рассчитано для C13H9ClN4O3S: 336,0; получено m/z: 337,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,04 (с, 2H); 8,92 (д, J=0,6 Гц, 1H); 8,26 (с, 1H); 7,85 (с, 1H); 7,82 (с, 1H); 2,62 (с, 3H).

Пример 159: 1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадии А-В, с использованием на стадии А 3-хлор-4-трифторметилсульфаниланилина. МС (ИЭР/ХИ): рассчитано для C15H10ClF 3N4O3S: 418,0; получено m/z: 419,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6 ): 13,38 (с, 1H); 9,02 (д, J=0,7 Гц, 1H); 8,46 (с, 1H); 8,38 (с, 1H); 8,05 (с, 1H); 4,31 (кв, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение 1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 131, стадия С, с использованием этилового эфира 1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. МС (ИЭР/ХИ): рассчитано для C13H6 ClF3N4O3S: 390,0; получено m/z: 389,0 [M-H]-. 1H ЯМР (400 МГц, DMSO-d 6): 13,35 (с, 1H); 13,11 (с, 1H); 8,96 (д, J=0,6 Гц, 1H); 8,46 (с, 1H); 8,32 (с, 1H); 8,03 (с, 1H).

Пример 160: 1-(7-хлор-4-оксо-6-трифторметансульфонил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 157, с использованием на стадии А 1-(7-хлор-4-оксо-6-трифторметансульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 159, продукт стадии A) вместо этилового эфира 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. МС (ИЭР/ХИ): рассчитано для C13H6 ClF3N4O4S: 406,0; получено m/z: 407,0 [M+H]+;405,0[M-H] -. 1H ЯМР (400 МГц, DMSO-d6): 13,46 (уш с, 1H); 13,12 (с, 1H); 8,97 (д, J=0,6 Гц, 1H); 8,54 (с, 1H); 8,33 (с, 1H); 8,03 (с, 1H).

Пример 161: 1-[4-оксо-6-(пирролидин-1-сульфонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 17, с использованием 4-(пирролидин-1-сульфонил)анилина вместо 3,4-диметоксианилина на стадии A и исключением очистки путем обращенно-фазовой ВЭЖХ на стадии B. МС (ИЭР/ХИ): рассчитано для C16H15N5O5S: 389,1; получено m/z: 390,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,31 (с, 1H); 13,09 (с, 1H); 9,00 (с, 1H); 8,40 (д, J=1,9 Гц, 1H); 8,32 (с, 1H); 8,19 (дд, J=8,6, 2,2 Гц, 1H); 7,89 (с, 1H); 3,25-3,10 (м, 4H); 1,74-1,59 (м, 4H).

Пример 162: 1-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-{этоксикарбониламино-[4-(пирролидин-1-карбонил)-фенилимино]-метил}-1H-пиразол-4-карбоновой кислоты. К суспензии (4-аминофенил)-пирролидин-1-ил-метанона (0,873 г, 4,59 ммоль) в DCM (15 мл) добавили этилизотиоцианатформат (0,60 мл, 5,1 ммоль) и перемешивали реакционную смесь при комнатной температуре в течение 1 ч. После этого добавили DIC (1,01 мл, 5,05 ммоль) и затем этилпиразол-4-карбоксилат (0,707 г, 5,05 ммоль). Перемешивание продолжали еще 18 ч, после чего реакционную смесь сконцентрировали. К остатку добавили диэтиловый эфир (25 мл), полученную суспензию охладили до 0°C и отфильтровали. Полученный фильтрат сконцентрировали и очистили остаток КФХ (EtOAc/гексаны 2-100%), получив искомое соединение (1,502 г, выход 77%). МС (ИЭР/ХИ): рассчитано для C21H25N5 O5: 427,2; получено m/z: 428,2 [M+H]+.

Стадия B. Получение этилового эфира 1-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-{этоксикарбониламино-[4-(пирролидин-1-карбонил)-фенилимино]-метил}-1H-пиразол-4-карбоновой кислоты (0,977 г, 2,29 ммоль) в DCE (5,5 мл) осторожно добавили хлорид титана (IV) (0,377 мл, 3,43 ммоль). Реакционную смесь выдержали при 100°C в течение 2,5 ч, затем охладили до комнатной температуры и разбавили этанолом (10 мл). Полученный раствор сконцентрировали и разделили остаток между DCM (30 мл) и водой (30 мл). Обе фазы профильтровали для удаления твердого побочного продукта и затем разделили. Водную фазу промыли DCM (30 мл), объединенные органические фазы промыли насыщенным солевым раствором (30 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток растерли с диэтиловым эфиром и затем с этанолом, получив искомое соединение (18 мг, выход 2,0%). МС (ИЭР/ХИ): рассчитано для C19H19N5O4: 381,1; получено m/z: 382,1 [M+H]+.

Стадия C. Получение 1-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору 1-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (18,0 мг, 43,1 мкмоль) в THF (0,2 мл) добавили 1 М водного раствора KOH (0,13 мл, 0,13 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 2 суток и затем сконцентрировали. Полученный остаток повторно растворили в воде (2 мл) и подкислили 1 М водного раствора HCl (0,5 мл). Выпавший осадок собрали фильтрованием и получили искомое соединение (11 мг, выход 70%). МС (ИЭР/ХИ): рассчитано для C17H15N5O 4: 353,1; получено m/z: 354,1 [M+H]+. 1 H ЯМР (600 МГц, DMSO-d6): 13,24-12,75 (м, 2H); 8,98 (с, 1H); 8,28 (с, 1H); 8,23 (с, 1H); 7,97 (д, J=8,3 Гц, 1H); 7,73 (с, 1H); 3,51 (т, J=6,8 Гц, 2H); 3,45 (т, J=6,5 Гц, 2H); 1,95-1,78 (м, 4H).

Пример 163: 1-[6-(2,6-диметилфенилкарбамоил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 4-амино-N-(2,6-диметилфенил)-бензамида. К раствору DMF (1,7 мл, 22 ммоль) в DCM (22 мл) при температуре 0°C по каплям добавили оксалилхлорид (1,9 мл, 22 ммоль). Полученную пенистую суспензию белого цвета перемешали в течение 30 мин, дали прогреться до комнатной температуры и затем снова охладили до 0°C. После этого добавили 4-аминобензойную кислоту (1,50 г, 10,9 ммоль) и перемешивали реакционную смесь при комнатной температуре в течение 1 ч. Затем колбу снова охладили до 0°C и добавили DCM (11 мл) и пиридин (2,6 мл, 33 ммоль). Перемешивание продолжали еще 50 мин, после чего добавили 2,6-диметилфениламин (1,33 г, 10,9 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 1,5 ч и сконцентрировали до сухого состояния. Полученный остаток растворили в этаноле (30 мл) и добавили 1,2-этилендиамин (3,3 мл, 49 ммоль). Реакционную смесь кипятили с обратным холодильником в течение 2 ч, затем дали остыть до комнатной температуры, перемешивали в течение 2 суток и сконцентрировали. К полученному остатку добавили воду (50 мл), выпавший осадок собрали, хорошо промыли водой и высушили, получив искомое соединение (1,904 г, выход 70%). МС (ИЭР/ХИ): рассчитано для C15H16N2 O: 240,1; получено m/z: 241,1 [M+H]+. 1 H ЯМР (400 МГц, CD3OD): 7,76 (д, J=8,8 Гц, 2H); 7,10 (с, 3H); 6,72 (д, J=8,8 Гц, 2H); 2,24 (с, 6H).

Стадия B. Получение 1-[6-(2,6-диметилфенилкарбамоил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 162, с использованием на стадии А 4-амино-N-(2,6-диметилфенил)-бензамида (полученного в соответствии с методикой, описанной в работе J. Org. Chem. 2008, 73, 8954-8959). МС (ИЭР/ХИ): рассчитано для C21H17N5O4: 403,1; получено m/z: 404,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,07 (с, 2H); 10,08 (с, 1H); 9,01 (с, 1H); 8,81 (с, 1H); 8,39 (д, J=7,7 Гц, 1H); 8,30 (с, 1H); 7,81 (д, J=7,6 Гц, 1H); 7,14 (с, 3H); 2,21 (с, 6H).

Пример 164: 1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 6-нитро-1H-хиназолин-2,4-диона. Мочевину (9,89 г, 0,165 моль) и 5-нитроантраниловую кислоту (6,00 г, 32,9 ммоль) энергично перемешивали в течение 1 ч при 200°C. Полученному расплаву дали остыть до 150°C и медленно добавили воду (150 мл). Полученную суспензию диспергировали ультразвуком в течение 1 ч и энергично перемешивали еще 2 ч. Затем ее охладили до 0°C, выпавший осадок собрали и промыли водой, получив искомое соединение (6,43 г, выход 94%). Полученное вещество высушили в вакуумной печи и использовали без дополнительной очистки. Для данного соединения не были получены масс-спектрометрические данные.

Стадия B. Получение 2,4-дихлор-6-нитрохиназолина. К суспензии 6-нитро-1H-хиназолин-2,4-диона (5,01 г, 24,2 ммоль) в толуоле (100 мл) добавили оксихлорид фосфора (6,64 мл, 72,6 ммоль) и нагрели реакционную смесь до 55°C. Затем в течение 25 минут при помощи капельной воронки по каплям добавили три-н-пропиламин (12,1 мл, 63,9 ммоль). Реакционную смесь выдержали при 110°C в течение 6 ч, перемешивали при комнатной температуре в течение 4 суток, затем пипеткой перенесли в воду (75 мл) и энергично перемешивали в течение 1 ч. Две образовавшиеся фазы профильтровали и разделили. Органическую фазу промыли насыщенным солевым раствором (30 мл), высушили над MgSO4 и сконцентрировали, получив искомое соединение (3,79 г, выход 67%, чистота 95%) через 24 ч под высоким вакуумом. Для данного соединения не были получены масс-спектрометрические данные. 1H ЯМР (600 МГц, CDCl 3): 9,18 (д, J=2,4 Гц, 1H); 8,75 (дд, J=9,2, 2,5 Гц, 1H); 8,18 (д, J=9,2 Гц, 1H).

Стадия C. Получение 2-хлор-6-нитро-3H-хиназолин-4-она. К 2,4-дихлор-6-нитрохиназолину (3,61 г, 14,8 ммоль) добавили 2 М водного раствора NaOH (22,2 мл, 44,4 ммоль). Полученную смесь диспергировали ультразвуком, перемешали при комнатной температуре в течение 3 ч и профильтровали, промывая водой (60 мл). К собранному фильтрату добавили уксусную кислоту (3,81 мл, 66,6 ммоль) и получили осадок, который собрали и высушили в вакуумной печи, получив искомое соединение (2,99 г, выход 90%). Для данного соединения не были получены масс-спектрометрические данные. 1 H ЯМР (400 МГц, CDCl3): 9,07 (с, 1H); 8,56 (д, J=8,9 Гц, 1H); 7,78 (д, J=8,8 Гц, 1H).

Стадия D. Получение этилового эфира 1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К суспензии 2-хлор-6-нитро-3H-хиназолин-4-она (2,95 г, 13,1 ммоль) в ксилоле (52 мл) добавили этилпиразол-4-карбоксилат (1,83 г, 13,1 ммоль). Реакционную смесь выдержали при 130°C в течение 1 ч, затем дали остыть и перемешивали при комнатной температуре в течение 18 ч. Выпавший осадок собрали и промыли эфиром (20 мл), получив искомое соединение (4,22 г, 98%). МС (ИЭР/ХИ): рассчитано для C14H11N5 O5: 329,1; получено m/z: 330,1 [M+H]+.

Стадия E. Получение 1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 1, стадия С. Конечное соединение получили растиранием из DMSO. МС (ИЭР/ХИ): рассчитано для C12H7 N5O5: 301,0; получено m/z: 302,2 [M+H] +, 300,1 [M-H]-. 1H ЯМР (400 МГц, DMSO-d6): 13,47 (с, 1H); 13,11 (с, 1H); 9,02 (с, 1H); 8,80 (д, J=2,7 Гц, 1H); 8,58 (дд, J=9,0, 2,7 Гц, 1H); 8,33 (с, 1H); 7,88 (д, J=8,7 Гц, 1H).

Пример 165: 1-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[6-нитро-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К суспензии этилового эфира 1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 164, продукт стадии D) (4,21 г, 12,8 ммоль) в THF (64 мл) добавили DIEA (4,41 мл, 25,6 ммоль) и затем (2-хлорметоксиэтил)-триметилсилан (2,49 мл, 14,1 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем сконцентрировали. Полученный остаток разделили между водой (75 мл) и EtOAc (75 мл), органическую фазу промыли водой (2 x 75 мл) и насыщенным солевым раствором (50 мл), высушили над MgSO4 и сконцентрировали, получив искомое соединение (5,92 г, выход 86%, чистота 85%). Полученное вещество использовали на следующей стадии без дополнительной очистки. МС (ИЭР/ХИ): рассчитано для C20H25N5O 6Si: 459,2; получено m/z: 402,1 [M+H-58]+.

Стадия B. Получение этилового эфира 1-[6-амино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-нитро-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (5,92 г, чистота 85%, 10,9 ммоль) в ацетоне (46 мл) добавили хлорид аммония (4,10 г, 76,6 ммоль) и воду (9,1 мл). Затем при энергичном перемешивании небольшими порциями добавили цинковую пыль (5,01 г, 76,6 ммоль). Перемешивание продолжали еще 45 мин, после чего реакционную смесь профильтровали через кизельгур. Отфильтрованный осадок тщательно промыли EtOAc (100 мл). Собранный фильтрат сконцентрировали и растворили остаток в EtOAc (75 мл), слив со слоя оставшихся солей. Полученную органическую фазу промыли насыщенным солевым раствором (45 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 2-70%) и получили искомое соединение (4,19 г, выход 89%). МС (ИЭР/ХИ): рассчитано для C20H27N5 O4Si: 430,2; получено m/z: 429,2 [M+H]+ . 1H ЯМР (400 МГц, CDCl3): 8,56 (д, J=0,6 Гц, 1H); 8,15 (д, J=0,6 Гц, 1H); 7,53 (д, J=8,6 Гц, 1H); 7,49 (д, J=2,6 Гц, 1H); 7,13 (дд, J=8,6, 2,8 Гц, 1H); 5,78 (с, 2H); 4,35 (кв, J=7,1 Гц, 2H); 4,09 (с, 2H); 3,57-3,43 (м, 2H); 1,37 (т, J=7,1 Гц, 3H); 0,86-0,74 (м, 2H); -0,08 (с, 9H).

Стадия C. Получение этилового эфира 1-[6-бензоиламино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-амино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,200 г, 0,466 ммоль) и TEA (0,162 мл, 1,16 ммоль) в DCM (2,3 мл) по каплям добавили бензоилхлорид (81,1 мкл, 0,698 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 1,5 ч, затем разбавили DCM (25 мл) и погасили водой (15 мл). Органическую фазу промыли водой (20 мл) и насыщенным солевым раствором (20 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 10-70%) и получили искомое соединение (0,240 г, выход 97%). МС (ИЭР/ХИ): рассчитано для C27H31N5O5Si: 533,2; получено m/z: 476,2 [M+H-58]+.

Стадия D. Получение этилового эфира 1-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-бензоиламино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,239 г, 0,488 ммоль) в диоксане (2,0 мл) добавили соляную кислоту (4 М раствора в диоксане, 2,0 мл, 8,0 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч, затем добавили эфир (10 мл) и собрали выпавший осадок, получив искомое соединение (0,157 г, выход 86%). МС (ИЭР/ХИ): рассчитано для C21H17N5O4: 403,1; получено m/z: 404,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 12,87 (с, 1H); 10,62 (с, 1H); 9,01 (с, 1H); 8,69 (с, 1H); 8,32 (с, 1H); 8,23 (дд, J=8,9, 2,4 Гц, 1H); 8,06-7,96 (м, 2H); 7,84-7,49 (м, 4H); 4,31 (кв, J=7,1 Гц, 2H); 1,33 (т, J=7,1 Гц, 3H).

Стадия E. Получение 1-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,142 г, 0,343 ммоль) в THF (1,0 мл) добавили 1 М водного раствора KOH (1,06 мл, 1,06 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем концентрировали. Полученный остаток повторно растворили в воде (5 мл) и довели до pH 1 при помощи 1 М водного раствора HCl (3 мл). Выпавший осадок собрали фильтрованием и получили искомое соединение (0,110 г, выход 82%). МС (ИЭР/ХИ): рассчитано для C19H 13N5O4: 375,1; получено m/z: 376,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6 ): 12,99 (с, 1H); 12,79 (с, 1H); 10,60 (с, 1H); 8,95 (с, 1H); 8,68 (с, 1H); 8,26 (с, 1H); 8,23 (дд, J=8,8, 2.4 Гц, 1H); 8,04-7,99 (м, 2H); 7,71 (д, J=7,8 Гц, 1H); 7,65-7,60 (м, 1H); 7,59-7,54 (м, 2H).

Пример 166: 1-[6-(2,6-диметилбензоиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение 2,6-диметилбензоилхлорида. К раствору 2,6-диметилбензойной кислоты (0,100 г, 0,666 ммоль) в тионилхлориде (0,50 мл, 6,9 ммоль) добавили DMF (2 капли). Реакционную смесь перемешали в течение 2 ч и сконцентрировали, получив искомое соединение, которое использовали на следующей стадии без дополнительной очистки.

Стадия B. Получение 1-[6-(2,6-диметилбензоиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 165, стадии C-E, с использованием на стадии С 2,6-диметилбензоилхлорида вместо бензоилхлорида. МС (ИЭР/ХИ): рассчитано для C21 H17N5O4: 403,1; получено m/z: 404,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,00 (с, 1H); 12,83 (с, 1H); 10,78 (с, 1H); 8,95 (с, 1H); 8,72 (с, 1H); 8,25 (с, 1H); 8,03 (дд, J=8,8, 2,4 Гц, 1H); 7,69 (д, J=8,8 Гц, 1H); 7,29-7,23 (м, 1H); 7,14 (д, J=7,5 Гц, 2H); 2,30 (с, 6H).

Пример 167: 1-(6-ацетиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 165, с использованием на стадии С ацетилхлорида вместо бензоилхлорида. МС (ИЭР/ХИ): рассчитано для C14H11N5O4: 313,1; получено m/z: 314,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 12,97 (с, 1H); 12,73 (с, 1H); 10,30 (с, 1H); 8,92 (д, J=0,6 Гц, 1H); 8,48 (с, 1H); 8,25 (с, 1H); 7,94 (дд, J=8,8, 2,5 Гц, 1H); 7,65 (д, J=8,6 Гц, 1H); 2,10 (с, 3H).

Пример 168: 1-[4-оксо-6-(3-фенилуреидо)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[4-оксо-6-(3-фенилуреидо)-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-амино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,240 г, 0,559 ммоль) в THF (11,2 мл) по каплям прибавили бензилизоцианат (79,2 мкл, 0,729 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 24 ч, а затем при 50°C в течение 18 ч. После этого добавили еще одну аликвоту бензилизоцианата (60,9 мкл, 0,561 ммоль) и продолжали нагрев в течение еще 6 ч. Затем реакционную смесь сконцентрировали и разделили остаток между EtOAc (30 мл) и водой (30 мл). Полученную водную фазу экстрагировали EtOAc (30 мл), объединенные органические фазы промыли насыщенным солевым раствором (30 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны) и получили искомое соединение (0,287 г, выход 94%). МС (ИЭР/ХИ): рассчитано для C27H32N6O5Si: 548,2; получено m/z: 491,2 [M+H-58]+.

Стадия B. Получение 1-[4-оксо-6-(3-фенилуреидо)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали способом, аналогичным описанному в Примере 165, стадии D-E. МС (ИЭР/ХИ): рассчитано для C 19H14N6O4: 390,1; получено m/z: 391,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,22-12,51 (м, 2H); 9,12 (с, 1H); 8,93 (д, J=0,7 Гц, 1H); 8,80 (с, 1H); 8,37 (д, J=2,5 Гц, 1H); 8,25 (с, 1H); 7,81 (дд, J=8,9, 2,6 Гц, 1H); 7,65 (д, J=8,8 Гц, 1H); 7,49 (дд, J=8,6, 1,1 Гц, 2H); 7,31 (дд, J=10,7, 5,2 Гц, 2H); 7,04-6,96 (м, 1H).

Пример 169: 1-(6-бензолсульфониламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[6-бензолсульфониламино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-амино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,200 г, 0,466 ммоль) в пиридине (2,3 мл) по каплям добавили бензолсульфонилхлорид (0,131 мл, 1,02 ммоль). Реакционную смесь перемешали в течение 2 ч, затем погасили водой (15 мл) и экстрагировали EtOAc (30 мл). Органическую фазу промыли водой (15 мл) и насыщенным солевым раствором (15 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 5-50%) и получили искомое соединение (0,253 мг, выход 95%). МС (ИЭР/ХИ): рассчитано для C26H 31N5O6SSi: 569,2; получено m/z: 512,1 [M+H-58]+.

Стадия B. Получение 1-(6-бензолсульфониламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 165, стадии D-E. МС (ИЭР/ХИ): рассчитано для C 18H13N5O5S: 411,1; получено m/z: 412,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 12,97 (с, 1H); 12,80 (с, 1H); 10,71 (с, 1H); 8,88 (с, 1H); 8,22 (с, 1H); 7,81 (с, 1H); 7,79 (д, J=7,3 Гц, 2H); 7,64-7,53 (м, 5H).

Пример 170: 1-(6-метансульфониламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 169, с использованием на стадии A метансульфонилхлорида вместо бензолсульфонилхлорида. МС (ИЭР/ХИ): рассчитано для C13H11N5O 5S: 349,1; получено m/z: 350,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,00 (с, 1H); 12,88 (с, 1H); 10,18 (с, 1H); 8,93 (с, 1H); 8,25 (с, 1H); 7,95 (с, 1H); 7,75-7,62 (м, 2H); 3,06 (с, 3H).

Пример 171: 1-(6-бензиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[6-бензиламино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. В пробирку поместили этиловый эфир 1-[6-амино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,250 г, 0,582 ммоль), бензальдегид (59,2 мкл, 0,582 ммоль) и молекулярные сита размером 4 Å (0,25 г). Затем добавили DCE (1,9 мл) и перемешивали реакционную смесь при комнатной температуре в течение 18 ч. После этого добавили триацетоксиборгидрид натрия (0,308 г, 1,46 ммоль) и перемешивали реакционную смесь еще 24 ч. Полученную реакционную смесь погасили насыщенным водным раствором бикарбоната натрия (10 мл) и затем экстрагировали DCM (3 x 15 мл). Объединенные органические фазы промыли насыщенным солевым раствором (20 мл), высушили над MgSO4 и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 2-40%) и получили искомое соединение (0,273 г, выход 90%). МС (ИЭР/ХИ): рассчитано для C27H33N5O4Si: 519,2; получено m/z: 520,2 [M+H]+.

Стадия B. Получение 1-(6-бензиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 165, стадии D-E. На стадии D перед растиранием продукта из диэтилового эфира упарили диоксан. МС (ИЭР/ХИ): рассчитано для C19H15N5O3: 361,1; получено m/z: 362,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 12,93 (с, 1H); 12,44 (с, 1H); 8,85 (д, J=0,6 Гц, 1H); 8,19 (с, 1H); 7,46 (д, J=8,7 Гц, 1H); 7,39 (д, J=7,7 Гц, 2H); 7,34 (т, J=7,7 Гц, 2H); 7,28-7,19 (м, 2H); 7,09 (д, J=2,7 Гц, 1H); 6,92 (с, 1H); 4,38 (с, 2H).

Пример 172: 1-(6-этиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-[6-этиламино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-амино-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (0,250 г, 0,582 моль) в этаноле (1,9 г) с молекулярными ситами размером 4 Å (0,35 г) добавили ацетальдегид (1 мл). Реакционную смесь перемешивали при комнатной температуре в течение 18 ч и затем профильтровали. Затем под высоким вакуумом удалили этанол и ацетальдегид. Полученный остаток повторно растворили в DCE (1,5 мл) и добавили триацетоксиборгидрид натрия (0,308 г, 1,46 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 6 суток, затем разбавили EtOAc (30 мл) и промыли насыщенным водным раствором бикарбоната натрия (20 мл). Водную фазу экстрагировали EtOAc (30 мл), объединенные органические фазы промыли насыщенным солевым раствором (20 мл), высушили (над MgSO4) и сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 5-65%) и получили искомое соединение (87,0 мг, выход 33%). МС (ИЭР/ХИ): рассчитано для C22H 31N5O4Si: 457,2; получено m/z: 458,2 [M+H]+.

Стадия B. Получение 1-(6-этиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 165, стадии D-E. На стадии D перед растиранием продукта из эфира упарили диоксан. МС (ИЭР/ХИ): рассчитано для C14 H13N5O3: 299,1; получено m/z: 300,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,04-12,24 (м, 2H); 8,85 (д, J=0,7 Гц, 1H); 8,19 (с, 1H); 7,46 (д, J=8,8 Гц, 1H); 7,16 (дд, J=8,8, 2,7 Гц, 1H); 7,06 (д, J=2,7 Гц, 1H); 6,23 (с, 1H); 3,12 (уш кв, J=7,0 Гц, 2H); 1,21 (т, J=7,1 Гц, 3H).

Пример 173: 1-[6-(2-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 2-метилбензальдегида вместо бензальдегида. МС (ИЭР/ХИ): рассчитано для C20H17N5O3: 375,1; получено m/z: 376,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 12,92 (с, 1H); 12,46 (с, 1H); 8,86 (д, J=0,5 Гц, 1H); 8,19 (с, 1H); 7,46 (д, J=8,8 Гц, 1H); 7,28 (д, J=7,1 Гц, 1H); 7,26-7,12 (м, 4H); 7,09 (с, 1H); 6,74 (с, 1H); 4,31 (д, J=5,2 Гц, 2H); 2,36 (с, 3H).

Пример 174: 1-[6-(2-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 2-хлорбензальдегида вместо бензальдегида. МС (ИЭР/ХИ): рассчитано для C19H14ClN5O3: 395,1; получено m/z: 396,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 12,93 (с, 1H); 12,48 (с, 1H); 8,86 (д, J=0,6 Гц, 1H); 8,19 (с, 1H); 7,53-7,46 (м, 2H); 7,40 (дд, J=5,9, 3,5 Гц, 1H); 7,33-7,28 (м, 2H); 7,23 (д, J=9,0 Гц, 1H); 7,03 (д, J=2,2 Гц, 1H); 6,95 (с, 1H); 4,44 (д, J=4,6 Гц, 2H).

Пример 175: 1-[6-(2,6-диметилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 2,6-диметилбензальдегида вместо бензальдегида. МС (ИЭР/ХИ): рассчитано для C21H19N5O 3: 389,2; получено m/z: 390,2 [M+H]+. 1 H ЯМР (400 МГц, DMSO-d6): 12,92 (с, 1H); 12,49 (с, 1H); 8,88 (д, J=0,7 Гц, 1H); 8,20 (с, 1H); 7,47 (д, J=8,8 Гц, 1H); 7,30 (дд, J=8,7, 2,7 Гц, 1H); 7,23 (д, J=2,5 Гц, 1H); 7,17-7,05 (м, 3H); 6,23 (т, J=3,9 Гц, 1H); 4,21 (д, J=4,1 Гц, 2H); 2,35 (с, 6H).

Пример 176: 1-[6-(2,6-дифторбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 2,6-дифторбензальдегида вместо бензальдегида. МС (ИЭР/ХИ): рассчитано для C19H13F2N 5O3: 397,1; получено m/z: 398,1 [M+H]+ . 1H ЯМР (600 МГц, DMSO-d6): 12,94 (с, 1H); 12,49 (с, 1H); 8,86 (д, J=0,6 Гц, 1H); 8,21 (с, 1H); 7,48 (д, J=8,6 Гц, 1H); 7,46-7,39 (м, 1H); 7,25 (дт, J=8,7, 2,7 Гц, 2H); 7,18-7,11 (м, 2H); 6,69 (с, 1H); 4,37 (с, 2H).

Пример 177: 1-[6-(2-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 2-цианобензальдегида вместо бензальдегида и очисткой искомого соединения путем обращенно-фазовой ВЭЖХ. МС (ИЭР/ХИ): рассчитано для C20H14N6O3: 386,1; получено m/z: 387,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,23 (с, 1H); 13,09 (с, 1H); 10,18 (с, 1H); 9,30 (с, 1H); 9,02 (с, 1H); 8,44 (с, 1H); 8,32 (д, J=7,8 Гц, 2H); 8,10 (д, J=9,2 Гц, 1H); 7,94 (с, 1H); 7,89 (дд, J=11,3, 4,7 Гц, 1H); 7,84 (д, J=7,7 Гц, 1H); 7,75 (т, J=7,7 Гц, 1H); 5,36 (с, 2H).

Пример 178: 1-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 3-цианобензальдегида вместо бензальдегида. На стадии C получили смесь искомого соединения, 1-[6-(3-карбамоилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты и 1-[6-амино-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты, которую разделили с использованием обращенно-фазовой ВЭЖХ.

Данные для 1-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты: МС (ИЭР/ХИ): рассчитано для C20H14 N6O3: 386,1; получено m/z: 387,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 12,93 (с, 1H); 12,48 (с, 1H); 8,85 (д, J=0,5 Гц, 1H); 8,19 (с, 1H); 7,83 (с, 1H); 7,73 (дд, J=7,8, 1,2 Гц, 2H); 7,57 (т, J=7,8 Гц, 1H); 7,47 (д, J=8,8 Гц, 1H); 7,23 (д, J=6,5 Гц, 1H); 7,08 (д, J=2,1 Гц, 1H); 6,99 (т, J=5,9 Гц, 1H); 4,46 (д, J=5,9 Гц, 2H).

Пример 179: 1-[6-(3-карбамоилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 3-цианобензальдегида вместо бензальдегида. На стадии C получили смесь 1-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты, искомого соединения и 1-[6-амино-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты, которую разделили с использованием обращенно-фазовой ВЭЖХ.

Данные для 1-[6-(3-карбамоилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты: МС (ИЭР/ХИ): рассчитано для C20H16 N6O4: 404,1; получено m/z: 405,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 12,92 (с, 1H); 12,45 (с, 1H); 8,85 (д, J=0,6 Гц, 1H); 8,18 (с, 1H); 7,96 (с, 1H); 7,92 (с, 1H); 7,75 (д, J=7,8 Гц, 1H); 7,53 (д, J=7,6 Гц, 1H); 7,46 (д, J=8,8 Гц, 1H); 7,42 (т, J=7,7 Гц, 1H); 7,36 (с, 1H); 7,28-7,19 (м, 1H); 7,08 (д, J=2,4 Гц, 1H); 6,96 (т, J=5,8 Гц, 1H); 4,42 (д, J=5,7 Гц, 2H).

Пример 180: 1-[6-амино-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 3-цианобензальдегида вместо бензальдегида. На стадии C получили смесь 1-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты, 1-[6-(3-карбамоил-бензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты и искомого соединения. Смесь разделили с использованием обращенно-фазовой ВЭЖХ; искомое соединение выделили в виде соли трифторуксусной кислоты.

Данные для 1-[6-амино-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты, соль трифторуксусной кислоты: МС (ИЭР/ХИ): рассчитано для C12H9N5O3: 271,1; получено m/z: 272,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 12,93 (с, 1H); 12,40 (с, 1H); 8,85 (д, J=0,6 Гц, 1H); 8,20 (с, 1H); 7,43 (д, J=8,7 Гц, 1H); 7,24 (д, J=2,5 Гц, 1H); 7,12 (дд, J=8,7, 2,6 Гц, 1H); 5,84 (с, 3H).

Пример 181: 1-[6-(2,6-дихлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 2,6-дихлорбензальдегида вместо бензальдегида. МС (ИЭР/ХИ): рассчитано для C20H13Cl2N 5O3: 429,0; получено m/z: 430.2.1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 12,93 (с, 1H); 12,50 (с, 1H); 8,87 (д, J=0,6 Гц, 1H); 8,20 (с, 1H); 7,55 (д, J=8,1 Гц, 2H); 7,48 (д, J=8,6 Гц, 1H); 7,41 (дд, J=8,5, 7,8 Гц, 1H); 7,28 (д, J=8,6 Гц, 1H); 7,26 (с, 1H); 6,50 (с, 1H); 4,49 (д, J=4,5 Гц, 2H).

Пример 182: 1-[6-(3-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 3-хлорбензальдегида вместо бензальдегида. МС (ИЭР/ХИ): рассчитано для C19H14ClN5O3: 395,1; получено m/z: 396,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 8,86 (д, J=0,6 Гц, 1H); 8,20 (д, J=0,5 Гц, 1H); 7,48 (д, J=8,8 Гц, 1H); 7,44 (с, 1H); 7,42-7,29 (м, 3H); 7,24 (дд, J=8,8, 2,8 Гц, 1H); 7,09 (д, J=2,7 Гц, 1H); 4,41 (с, 2H).

Пример 183: 1-[6-(4-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 171, с использованием на стадии A 4-метилбензальдегида вместо бензальдегида. МС (ИЭР/ХИ): рассчитано для C20H17N5O3: 375,1; получено m/z: 376,3 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6) 12,90 (с, 1H); 12,46 (с, 1H); 8,85 (с, 1H); 8,19 (с, 1H); 7,45 (д, J=8,7 Гц, 1H); 7,27 (д, J=8,0 Гц, 2H); 7,21 (дд, J=8,9, 2,7 Гц, 1H); 7,15 (д, J=7,9 Гц, 2H); 7,07 (д, J=2,6 Гц, 1H); 6,87 (т, J=4,8 Гц, 1H); 4,32 (д, J=5,5 Гц, 2H); 2,27 (с, 3H).

Пример 184: 1-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Стадия A. Получение этилового эфира 1-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получили способом, аналогичным описанному в Примере 27, стадии C-D, с использованием на стадии C 3-иоданилина. МС (ИЭР): рассчитано для C14H11IN4 O3: 410,0; получено m/z: 411,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,04 (с, 1H); 9,00 (д, J=0,6 Гц, 1H); 8,34 (с, 1H); 8,11 (с, 1H); 7,85 (с, 2H); 4,30 (кв, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия B. Получение этилового эфира 1-[7-иод-3-(2-метоксиэтоксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (1,65 г, 4,02 ммоль) и THF (20 мл) добавили DIPEA (2,10 мл, 12,1 ммоль) и затем 1-хлорметокси-2-метоксиэтан (1,01 мл, 8,85 ммоль) при 23°C. После перемешивания в течение 18 ч реакционную смесь сконцентрировали при пониженном давлении. Полученный остаток использовали в последующих реакциях без дополнительной очистки (1,89 г, 94%). МС (ИЭР): рассчитано для C18 H19IN4O5: 498,0; получено m/z: 499,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,85 (д, J=0,6 Гц, 1H); 8,30 (д, J=0,6 Гц, 1H); 8,17 (д, J=1,4 Гц, 1H); 8,00 (дд, J=8,3, 1,6 Гц, 1H); 7,95 (д, J=8,3 Гц, 1H); 5,65 (с, 2H); 4,30 (кв, J=7,1 Гц, 2H); 3,50-3,48 (м, 2H); 3,26 - 3,23 (м, 2H); 3,05 (с, 3H); 1,31 (т, J=7,1 Гц, 3H).

Стадия C. Получение этилового эфира 1-[3-(2-метоксиэтоксиметил)-4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь карбоната калия (210 мг, 1,52 ммоль), фенилборной кислоты (156 мг, 1,28 ммоль), этилового эфира 1-[7-иод-3-(2-метоксиэтоксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (250 мг, 0,502 ммоль) и THF (4,4 мл) в течение 10 мин дегазировали азотом в герметично закрываемом реакторе. Затем к реакционной смеси добавили дихлорметановый аддукт 1,1'-бис(дифенилфосфин)ферроцен]дихлорпалладия (48,9 мг, 0,0610 ммоль) и герметично закрыли реактор. Полученную смесь перемешивали при температуре 80°C в течение 18 ч. Затем реакционную смесь охладили до 23°C, разбавили DCM (15 мл) и профильтровали. Полученный фильтрат сконцентрировали. Полученный остаток очистили КФХ (EtOAc/гексаны 5-45%) и получили искомое соединение (192 мг, 85%). МС (ИЭР): рассчитано для C 24H24N4O5: 448,2; получено m/z: 449,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,88 (д, J=0,6 Гц, 1H); 8,30 (д, J=0,6 Гц, 1H); 8,04 (д, J=1,5 Гц, 1H); 8,00 (дд, J=8,3, 1,8 Гц, 1H); 7,88-7,84 (м, 2H); 7,78 (дд, J=8,0, 1,5 Гц, 1H); 7,58-7,52 (м, 2H); 7,51-7,46 (м, 1H); 5,67 (с, 2H); 4,30 (кв, J=7,1 Гц, 2H); 3,54-3,50 (м, 2H); 3,29-3,25 (м, 2H); 3,08 (с, 3H); 1,32 (т, J=7,1 Гц, 3H).

Стадия D. Получение этилового эфира 1-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К этиловому эфиру 1-[3-(2-метоксиэтоксиметил)-4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (90,0 мг, 0,201 ммоль) добавили 4 M раствора HCl в диоксане (3,00 мл, 12,0 ммоль). Полученную реакционную смесь перемешивали при 23°C. Через 18 ч реакционную смесь сконцентрировали при пониженном давлении. Затем добавили Et2O (5 мл), выпавший осадок собрали фильтрованием и хорошо промыли Et2O, получив искомое соединение (38,0 мг, 53%). МС (ИЭР): рассчитано для C20 H16N4O3: 360,1; получено m/z: 361,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 12,93 (с, 1H); 9,04 (с, 1H); 8,34 (с, 1H); 8,20 (д, J=8,2 Гц, 1H); 7,98 (с, 1H); 7,84 (дд, J=10,5, 4,2 Гц, 3H); 7,55 (т, J=7,6 Гц, 2H); 7,49-7,46 (м, 1H); 4,31 (кв, J=7,1 Гц, 2H); 1,33 (т, J=7,1 Гц, 3H).

Стадия E. Получение 1-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты (48,0 мг, 0,133 ммоль), воды (0,8 мл) и THF (0,8 мл) добавили гидроксид калия (37,4 мг, 0,666 ммоль). Полученную смесь перемешивали в течение 16 ч при 23°C. Затем реакционную смесь сконцентрировали при пониженном давлении для удаления THF, а оставшуюся водную фазу подкислили до pH 2 1 М водного раствора HCl. Выпавший осадок собрали фильтрованием и получили искомое соединение (42,0 мг, 85%). МС (ИЭР): рассчитано для C18 H12N4O3: 332,1; получено m/z: 333,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,45 (д, J=0,8 Гц, 1H); 7,99 (д, J=8,2 Гц, 1H); 7,78-7,72 (м, 2H); 7,62 (д, J=1,5 Гц, 1H); 7,55 (д, J=0,8 Гц, 1H); 7,49 (т, J=7,6 Гц, 2H); 7,41-7,36 (м, 2H).

Пример 185: 1-[7-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 184, стадии C-E, с использованием на стадии С этилового эфира 1-[7-иод-3-(2-метоксиэтоксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 184, продукт стадии B) и 2-хлорфенилборной кислоты. МС (ИЭР): рассчитано для C 18H11ClN4O3: 366,1; получено m/z: 367,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,02 (уш с, 1H); 12,92 (уш с, 1H); 8,97 (с, 1H); 8,28 (с, 1H); 8,22 (д, J=6,6 Гц, 1H); 7,71 (с, 1H); 7,67-7,62 (м, 1H); 7,58 (д, J=7,3 Гц, 1H); 7,55-7,47 (м, 3H).

Пример 186: 1-[7-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 184, стадии C-E, с использованием на стадии С этилового эфира 1-[7-иод-3-(2-метоксиэтоксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 184, продукт стадии B) и 3-хлорфенилборной кислоты. МС (ИЭР): рассчитано для C 18H11ClN4O3: 366,1; получено m/z: 367,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,04 (уш с, 1H); 12,94 (уш с, 1H); 8,97 (с, 1H); 8,28 (с, 1H); 8,21 (д, J=8,0 Гц, 1H); 8,00 (с, 1H); 7,91 (с, 1H); 7,87 (д, J=8,4 Гц, 1H); 7,82 (д, J=6,7 Гц, 1H); 7,60-7,52 (м, 2H).

Пример 187: 1-[7-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 184, стадии C-E, с использованием на стадии C этилового эфира 1-[7-иод-3-(2-метоксиэтоксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 184, продукт стадии B) и 4-хлорфенилборной кислоты. МС (ИЭР): рассчитано для C 18H11ClN4O3: 366,1; получено m/z: 367,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,99 (уш с, 2H); 8,97 (д, J=0,6 Гц, 1H); 8,28 (с, 1H); 8,20 (д, J=8,3 Гц, 1H); 7,97 (с, 1H); 7,87 (д, J=8,5 Гц, 2H); 7,83 (дд, J=8,3, 1,7 Гц, 1H); 7,63-7,58 (м, 2H).

Пример 188: 1-(4-оксо-7-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 184, стадии C-E, с использованием на стадии C этилового эфира 1-[7-иод-3-(2-метоксиэтоксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 184, продукт стадии B) и 2-метилфенилборной кислоты. МС (ИЭР): рассчитано для C 19H14N4O3: 346,1; получено m/z: 347,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 12,82 (уш с, 1H); 8,92 (с, 1H); 8,10 (с, 1H); 8,08 (д, J=8,1 Гц, 1H); 7,47 (с, 1H); 7,36-7,27 (м, 5H); 2,28 (с, 3H).

Пример 189: 1-(4-оксо-7-м-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 184, стадии C-E, с использованием на стадии C этилового эфира 1-[7-иод-3-(2-метоксиэтоксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточное соединение из Примера 184, продукт стадии B) и 3-метилфенилборной кислоты. МС (ИЭР): рассчитано для C 19H14N4O3: 346,1; получено m/z: 347,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,04 (с, 1H); 12,87 (с, 1H); 8,98 (с, 1H); 8,28 (с, 1H); 8,20 (д, J=8,2 Гц, 1H); 7,94 (с, 1H); 7,83 (д, J=8,1 Гц, 1H); 7,67 (с, 1H); 7,62 (д, J=7,0 Гц, 1H); 7,43 (т, J=7,6 Гц, 1H); 7,29 (д, J=7,5 Гц, 1H); 2,42 (с, 3H).

Пример 190: 1-(4-оксо-6-м-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 3-метилфенилборной кислоты. МС (ИЭР): рассчитано для C19H14N4 O3: 346,1; получено m/z: 347,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,02 (с, 1H); 12,91 (с, 1H); 8,98 (с, 1H); 8,34 (с, 1H); 8,27 (с, 1H); 8,17 (д, J=7,9 Гц, 1H); 7,78 (д, J=6,3 Гц, 1H); 7,62 (с, 1H); 7,58 (д, J=7,3 Гц, 1H); 7,41 (т, J=7,6 Гц, 1H); 7,24 (д, J=7,0 Гц, 1H); 2,42 (с, 3H).

Пример 191: 1-(4-оксо-6-п-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 4-метилфенилборной кислоты. МС (ИЭР): рассчитано для C19H14N4 O3: 346,1; получено m/z: 347,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,03 (с, 1H); 12,92 (с, 1H); 8,98 (с, 1H); 8,33 (с, 1H); 8,27 (с, 1H); 8,16 (д, J=7,9 Гц, 1H); 7,77 (с, 1H); 7,69 (д, J=8,0 Гц, 2H); 7,33 (д, J=7,9 Гц, 2H); 2,37 (с, 3H).

Пример 192: 1-[6-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 2-хлорфенилборной кислоты. МС (ИЭР): рассчитано для C18H11ClN 4O3: 366,1; получено m/z: 367,0 [M+H]+ . 1H ЯМР (600 МГц, DMSO-d6): 12,99 (с, 2H); 8,98 (д, J=0,6 Гц, 1H); 8,27 (с, 1H); 8,13 (д, J=2,1 Гц, 1H); 7,91 (дд, J=8,4, 2,1 Гц, 1H); 7,78 (д, J=8,4 Гц, 1H); 7,64-7,61 (м, 1H); 7,55-7,52 (м, 1H); 7,47 (кв. д, J=7,4, 1,8 Гц, 2H).

Пример 193: 1-[6-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 3-хлорфенилборной кислоты. МС (ИЭР): рассчитано для C18H11ClN 4O3: 366,1; получено m/z: 367,0 [M+H]+ . 1H ЯМР (600 МГц, DMSO-d6): 13,00 (уш с, 2H); 8,98 (с, 1H); 8,36 (д, J=2,2 Гц, 1H); 8,28 (с, 1H); 8,20 (дд, J=8,5, 2,3 Гц, 1H); 7,85 (т, J=1,9 Гц, 1H); 7,81-7,75 (м, 2H); 7,55 (т, J=7,9 Гц, 1H); 7,49 (ддд, J=8,0, 2,0, 1,0 Гц, 1H).

Пример 194: 1-[6-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 4-хлорфенилборной кислоты. МС (ИЭР): рассчитано для C18H11ClN 4O3: 366,1; получено m/z: 367,0 [M+H]+ . 1H ЯМР (600 МГц, DMSO-d6): 13,02 (с, 1H); 12,95 (с, 1H); 8,99 (с, 1H); 8,28 (с, 2H); 8,05 (д, J=8,5 Гц, 1H); 7,81 (с, 1H); 7,67 (т, J=7,9 Гц, 1H); 7,49 (тдд, J=7,1, 5,1, 1,7 Гц, 1H); 7,40-7,34 (м, 2H).

Пример 195: 1-[6-(2-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 2-фторфенилборной кислоты. МС (ИЭР): рассчитано для C18H11FN4 O3: 350,1; получено m/z: 351,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,02 (уш с, 1H); 12,95 (уш с, 1H); 8,99 (с, 1H); 8,28 (с, 2H); 8,05 (д, J=8,5 Гц, 1H); 7,81 (с, 1H); 7,67 (т, J=7,9, 1H); 7,49 (тдд, J=7,1, 5,1, 1,7, 1H); 7,40-7,34 (м, 2H).

Пример 196: 1-[6-(3-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 3-фторфенилборной кислоты. МС (ИЭР): рассчитано для C18H11FN4 O3: 350,1; получено m/z: 351,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,01 (уш с, 2H); 8,98 (с, 1H); 8,38 (д, J=2,0 Гц, 1H); 8,29 (с, 1H); 8,22-8,20 (м, 1H); 7,80 (д, J=8,0 Гц, 1H); 7,68-7,64 (м, 2H); 7,58-7,54 (м, 1H); 7,28-7,24 (м, 1H).

Пример 197: 1-[6-(4-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 4-фторфенилборной кислоты. МС (ИЭР): рассчитано для C18H11FN4 O3: 350,1; получено m/z: 351,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,01 (уш с, 1H); 12,92 (уш с, 1H); 8,98 (с, 1H); 8,32 (с, 1H); 8,28 (с, 1H); 8,16 (дд, J=8,5, 2,2 Гц, 1H); 7,88-7,82 (м, 2H); 7,79 (с, 1H); 7,37-7,32 (м, 2H).

Пример 198: 1-[6-(2-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 2-метоксифенилборной кислоты. МС (ИЭР): рассчитано для C19H14 N4O4: 362,1; получено m/z: 363,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 13,00 (уш с, 1H); 12,84 (уш с, 1H); 8,98 (с, 1H); 8,28 (с, 1H); 8,21 (д, J=1,7 Гц, 1H); 7,97 (дд, J=8,4, 2,1 Гц, 1H); 7,74 (д, J=7,0 Гц, 1H); 7,43-7,39 (м, 2H); 7,19 - 7,16 (м, 1H); 7,09 (тд, J=7,5, 1,0 Гц, 1H); 3,81 (с, 3H).

Пример 199: 1-[6-(3-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 3-метоксифенилборной кислоты. МС (ИЭР): рассчитано для C19H14 N4O4: 362,1; получено m/z: 363,1 [M+H] +. 1HЯМР (600 МГц, DMSO-d6 ): 13,01 (уш с, 1H); 12,91 (уш с, 1H); 8,98 (с, 1H); 8,34 (с, 1H); 8,28 (с, 1H); 8,18 (д, J=6,7 Гц, 1H); 7,78 (с, 1H); 7,44 (т, J=7,9 Гц, 1H); 7,35 (д, J=7,8 Гц, 1H); 7,29 (с, 1H); 7,00 (дд, J=8,2, 1,8 Гц, 1H); 3,86 (с, 3H).

Пример 200: 1-[6-(4-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 4-метоксифенилборной кислоты. МС (ИЭР): рассчитано для C19H14 N4O4: 362,1; получено m/z: 363,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 12,99 (уш с, 1H); 12,88 (уш с, 1H); 8,97 (с, 1H); 8,28 (д, J=13,9 Гц, 2H); 8,13 (д, J=8,4 Гц, 1H); 7,78-7,72 (м, 3H); 7,09-7,06 (м, 2H); 3,82 (с, 3H).

Пример 201: 1-[4-оксо-6-(2-трифторметилфенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 2-трифторметилфенилборной кислоты. МС (ИЭР): рассчитано для C19H11 F3N4O3: 400,1; получено m/z: 401,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,01 (уш с, 2H); 8,99 (с, 1H); 8,42 (д, J=1,6 Гц, 1H); 8,31-8,25 (м, 2H); 8,13 (д, J=7,6 Гц, 1H); 8,10 (с, 1H); 7,83 (с, 1H); 7,77 (дт, J=15,3, 7,8 Гц, 2H).

Пример 202: 1-[4-оксо-6-(2-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 2-трифторметоксифенилборной кислоты. МС (ИЭР): рассчитано для C19H11 F3N4O4: 416,1; получено m/z: 417,1 [M+H]+. 1HЯМР (600 МГц, DMSO-d6): 13,02 (с, 1H); 12,95 (с, 1H); 8,99 (с, 1H); 8,28 (с, 1H); 8,20 (с, 1H); 7,96 (д, J=7,5 Гц, 1H); 7,81 (с, 1H); 7,69-7,66 (м, 1H); 7,61-7,53 (м, 3H).

Пример 203: 1-[6-(2-этилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 2-этилфенилборной кислоты. МС (ИЭР): рассчитано для C20H16N4 O3: 360,1; получено m/z: 361,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,01 (уш с, 1H); 12,91 (уш с, 1H); 8,99 (с, 1H); 8,28 (с, 1H); 7,99 (с, 1H); 7,81 (дд, J=8,2, 1,8 Гц, 1H); 7,77 (с, 1H); 7,40-7,36 (м, 2H); 7,32-7,29 (м, 1H); 7,25 (д, J=7,2 Гц, 1H); 2,59 (кв, J=7,5 Гц, 2H); 1,05 (т, J=7,5 Гц, 3H).

Пример 204: 1-[6-(2,3-дигидробензо[1,4]диоксин-5-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии C-E, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 1,4-бензодиоксан-5-борной кислоты. МС (ИЭР): рассчитано для C20H14 N4O5: 390,1; получено m/z: 391,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 13,00 (с, 1H); 12,87 (с, 1H); 8,97 (с, 1H); 8,25 (с, 2H); 8,10 (д, J=7,8 Гц, 1H); 7,73 (с, 1H); 7,28-7,24 (м, 2H); 6,99 (д, J=8,4 Гц, 1H); 4,30 (с, 4H).

Пример 205: 1-[4-оксо-6-(3-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии С-Е, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 3-трифторметоксифенилборной кислоты. МС (ИЭР): рассчитано для C19H11 F3N4O4: 416,1; получено m/z: 417,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,06-12.92 (м, 2Н); 8,99 (с, 1H); 8,39 (с, 1H); 8,28 (с, 1H); 8,22 (дд, J=8,4, 1,8 Гц, 1H); 7,86 (д, J=8,0 Гц, 1H); 7,79 (с, 2Н); 7,66 (т, J=8,0 Гц, 1H); 7,46-7,40 (м, 1H).

Пример 206: 1-[6-(3-метансульфонилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии С-Е, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 3-(метилсульфонил)фенилборной кислоты. МС (ИЭР): рассчитано для C19H14 N4O5S: 410,1; получено m/z: 411,1 [M+H] +. 1H ЯМР (600 МГц, DMSO-d6): 13,01 (уш с, 2H); 8,99 (с, 1H); 8,47 (д, J=2,1 Гц, 1H); 8,31-8,27 (м, 3H); 8,18 (д, J=8,5 Гц, 1H); 7,97 (ддд, J=7,8, 1,7, 1,0 Гц, 1H); 7,85 (д, J=7,7 Гц, 1H); 7,80 (т, J=7,8 Гц, 1H); 3,34 (с, 3H).

Пример 207: 1-(6-бензо[1,3]диоксол-5-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 69, стадии С-Е, с использованием на стадии C этилового эфира 1-[6-иод-4-оксо-3-(2-триметилсиланилэтоксиметил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты (Пример 69, продукт стадии B) и 3,4-метилендиоксифенилборной кислоты. МС (ИЭР): рассчитано для C19H12 N4O5: 376,1; получено m/z: 377,1 [M+H] +. 1H ЯМР (500 МГц, DMSO-d6): 12,96 (уш с, 2H); 8,97 (с, 1H); 8,29-8,25 (м, 2Н); 8,11 (дд, J=8,5, 2,2 Гц, 1H); 7,75 (д, J=8,5 Гц, 1H); 7,38 (д, J=1,7 Гц, 1H); 7,27 (дд, J=8,1, 1,8 Гц, 1H); 7,05 (д, J=8,1 Гц, 1H); 6,10 (с, 2Н).

Пример 208: 1-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Искомое соединение получили способом, аналогичным описанному в Примере 184, стадия E, с использованием этилового эфира 1-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновой кислоты (Пример 184, продукт стадии А). МС (ИЭР): рассчитано для C12H7IN4O3: 382,0; получено m/z: 382,9 [M+H]+. 1H ЯМР (600 МГц, DMSO-d6): 13,06 (с, 1H); 12,99 (с, 1H); 8,94 (с, 1H); 8,27 (с, 1H); 8,09 (с, 1H); 7,85 (с, 2Н).

Следующие предполагаемые соединения могут быть синтезированы с использованием приведенных выше общих схем.

Пример 209: 1-(6-бензолсульфинил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

МС (ИЭР/ХИ): рассчитано для C 18H11ClN4O4S: 414,8.

Пример 210: 1-(6-бензолсульфонил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

МС (ИЭР/ХИ): рассчитано для C 18H11ClN4O5S: 430,8.

Пример 211: 1-(4-оксо-7-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота.

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

Вышеназванное соединение может быть получено по схеме B с использованием 3-пиперидин-1-ил-фениламина. МС (ИЭР/ХИ): рассчитано для C17H17N 5O3: 339,1.

Биологические протоколы:

Экспрессия и очистка PHD2181-417

Конструкцию для экспрессии PHD2 человека, содержащую аминокислоты 181-417 последовательности GenBank Accession ID NM_022051, клонировали в вектор pBAD (Invitrogen), вводя как N-концевую гистидиновую метку, так и Smt3-метку, обе из которых снимаются протеазой Ulp1. Белок нарабатывали экспрессией в клетках BL21, выращиваемых на богатой среде Terrific Broth, содержащей 100 мкг/мл ампициллина. Клеточные культуры инокулировали при 37°C и выращивали до получения оптической плотности OD600=0,8. Затем клеточные культуры индуцировали 0,1% раствором арабинозы и выращивали в течение ночи при температуре 20°C, непрерывно встряхивая с частотой 225 об/мин. Затем клетки собрали центрифугированием и хранили при температуре -80°C. Клеточную массу суспендировали в Буфере A (50 мМ Tris-HCl pH 7,2, 100 мМ NaCl, 100 мМ L-аргинина, 1 мМ TCEP, 0,05% (вес/об) NP-40, 50 мМ имидазола) и затем добавили к ней лизозим и эндонуклеазу Benzonase. Клетки лизировали на ультразвуковой бане, лизат очистили центрифугированием (15 000 об/мин, 90 мин, 4°C). Наработанный белок очистили с помощью никель-аффинной хроматографии на колонке HisTrap Crude FF (GE Healthcare). Образцы элюировали в Буфере A с градиентом имидазола 50-200 мМ. Отщепление сигнального пептида Smt протеазой Ulp1 проводили путем инкубирования в течение ночи с диализом от Буфера A. Затем полученный образец PHD2181-417 пропустили через вторую колонку HisTrap Crude FF (GE Healthcare) для удаления белка с неотщепленной меткой. Прошедший через вторую колонку раствор затем диализовали в раствор, содержащий 50 мМ MES pH 6,0, 1 мМ TCEP, 5 мМ NaCl, для ион-обменной хроматографии на катион-обменной колонке HiTrap SP Cation Exchange (GE Healthcare). Белок PHD2181-417 элюировали с градиентом NaCl 0-0,2 M. Собранные фракции объединили для дальнейшей очистки путем гель-проникающей хроматографии на колонке Superdex 75 Size Exclusion Column (GE Healthcare). Выделенный белок сконцентрировали до 4 мг/мл и диализовали в растворе, содержащем 10 мМ PIPES pH 7,0, 100 мМ NaCl, 0,5 мМ TCEP. По результатам гель-электрофорезного анализа чистота полученного белка составила >95%.

Анализ активности фермента

Анализ активности фермента PHD проводили в 0,5 мл реакционной смеси, содержащей следующие компоненты: очищенный полипептид PHD2181-417 (3 мкг), синтетический пептид HIF-1a, содержащий остатки [KNPFSTGDTDLDLEMLAPYIPMDDDFQLRSFDQLS] (10 мкМ, компания California Peptide Research Inc., Напа, шт. Калифорния, США) и [5-14C]-2-оксоглутаровую кислоту (50 мКи/ммоль, компания Moravek Chemicals, Бри, шт. Калифорния, США) в реакционном буферном растворе (40 мМ Tris-HCl, pH 7,5, 0,4 мг/мл каталазы, 0,5 мМ DTT, 1 мМ аскорбиновой кислоты) в течение 10 минут. Реакцию останавливали добавлением 50 мкл 70 мМ раствора H3PO4 и 50 мкл 500 мМ раствора NaH2PO4, pH 3,2. Наличие [14 C]-янтарной кислоты определяли путем отделения от [5-14 C]-2-оксоглутаровой кислоты при инкубации реакционной смеси с раствором 100 мкл 0,16 M раствора DNP в 30%-ной хлорной кислоте. Затем к реакционной смеси добавили 50 мкл раствора, содержащего 20 мМ немеченой 2-оксоглутаровой кислоты и 20 мМ немеченой янтарной кислоты, использующихся в качестве носителя радиоактивной метки, и полученную смесь оставили на 30 мин при комнатной температуре. Затем реакционную смесь инкубировали с 50 мкл 1 M раствора 2-оксоглутаровой кислоты для осаждения избытка DNP. После этого реакционную смесь центрифугировали на 2800 x г при комнатной температуре в течение 10 мин для отделения [14C]-янтарной кислоты в супернатанте от выпавшего в осадок [14C]-динитрофенилгидразона. Активность фракций супернатанта (400 мкл) определяли на счетчике бета-частиц (компания Beckman Coulter, Фуллертон, шт. Калифорния, США). Степень ингибирования активности PHD2181-417 определяли как понижение продукции [14C]-янтарной кислоты. Значения IC50 оценивали путем подгонки полученных данных трехпараметрической логистической функцией в программной среде GraphPad Prism, версия 4.02 (компания Graph Pad Software, Сан-Диего, шт. Калифорния, США).

Клеточный анализ

Клетки линии Hep-3B (компания ATCC, Манасас, шт. Вирджиния, США) высевали на 96-луночные планшеты с плотностью 20 000 клеток на лунку в 100 мкл среды DMEM с добавлением 10% эмбриональной бычьей сыворотки, 1% заменимых аминокислот, 50 МЕ/мл пенициллина и 50 мкг/мл стрептомицина (все реагенты для клеточной культуральной среды компании Invitrogen, Карлсбад, шт. Калифорния, США). Через 24 ч после посева в лунки добавляли анализируемые соединения и инкубировали планшет в течение еще 24 ч. Все соединения были протестированы в условиях насыщения при конечной концентрации соединения 100 мкМ. Пятьдесят мкл супернатанта затем переносили в диагностический набор реагентов для оценки гипоксии человека (компания Meso-Scale Discovery, Гейтсбург, шт. Мэрилэнд, США). Эритропоэтин в супернатанте определяли в соответствии с рекомендациями производителя набора следующим образом. Планшеты для детектирования ЭПО в течение ночи блокировали 3% BSA в фосфатном буфере, а 50 мкл супернатанта инкубировали при комнатной температуре на орбитальном шейкере в течение 2 ч. Затем в лунки добавили по двадцать пять микролитров 0,5 мкг/мл анти-ЭПО детектирующих антител и встряхивали планшет на орбитальном шейкере при комнатной температуре в течение 2 ч. После трехкратной промывки фосфатным буфером в лунки добавили по 150 мкл 1X буфера для измерений и измерили оптическую плотность на анализаторе MSD SECTOR. Полученные данные проанализировали путем определения процента секреции ЭПО в присутствии 100 мкм соединения по отношению к секреции ЭПО в присутствии контрольного соединения, 7-[(4-хлорфенил)-(5-метилизоксазол-3-иламино)-метил]-хинолин-8-ола.

Результаты тестирования соединений в описанных анализах представлены в Таблице 1 в виде усредненных значений полученных результатов (НТ=не тестировался). Соединения тестировали в виде свободного основания (*), гидрохлорида (^) или соли трифторуксусной кислоты (хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 ). Если активность показана как больше (>) некоторого значения, данное значение представляет собой самую высокую тестируемую концентрацию.

Таблица 1
ПримерХимическое название pIC50 ферментаКлеточный % стимуляции ЭПО
11-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,337
21-(7-трифторметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,821

31-(6,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,637
41-(6-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,415
51-(6,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,721
61-(5-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,819
71-(8-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,825
81-(6-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,414
91-(8-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,149
101-(7-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,332
111-(8-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,840
121-(6-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,650
131-(6-Бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,235
141-(8-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н- 6,68

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пиразол-4-карбоновая кислота; хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
15 1-(4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,819
161-(4-оксо-8-трифторметил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,616
171-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,733
181-(5,6,7-триметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,542
191-(6-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,445
201-(4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,6104
211-(6-циклогексил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,684
221-(7-хлор-4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,561
231-(1-оксо-2,7-дигидро-1H-пирроло[3,2-f]хиназолин-3-ил)-1Н-пиразол-4-карбоновая кислота;6,833
241-[6-(4-трет-бутил-фенилсульфанил)-7-хлор-4-оксо-1,4-дигидрохиназолин-2- 7,650

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 ил]-1H-пиразол-4-карбоновая кислота; хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
25 1-(7-хлор-4-оксо-6-фенилсульфанил-1,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,468
261-[7-хлор-6-(3,4-диметоксифенилсульфанил)-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота.7,555
271-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,710
281-[4-оксо-6-(3,4,5-триметоксифенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,79
291-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,6124
301-[6-(3-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,615
311-[6-(3-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7129
321-[6-(4-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,668

331-[6-(2-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,556
341-[6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,673
351-[6-(3,5-ди-трет-бутилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,58
361-(4-оксо-6-м-толилокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,422
371-(4-оксо-6-о-толилокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,678
381-[6-(2,6-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,791
391-[6-(2,4-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,677
401-[6-(2,5-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,677
411-[6-(4-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7112
421-[6-(2,6-диметилфенокси)-4- 7,6117

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
43 1-[6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,676
441-[4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,652
461-[6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,5126
471-(4-оксо-6-п-толилокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,595
481-[7-хлор-6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,551
491-[7-хлор-6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,555
501-[6-(2,6-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,567
511-[6-(2,6-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,6100

521-[7-фтор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,476
531-[7-хлор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,545
541-[7-хлор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,490
551-[7-хлор-4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,525
561-[7-фтор-6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,768
571-[7-фтор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7135
581-[7-фтор-6-(индан-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,562
591-(7-метил-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,680
601-[6-(2,3-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2- 7,570

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 ил]-1H-пиразол-4-карбоновая кислота; хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
61 1-[6-(2,6-диметилфенокси)-7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,786
621-(7-метокси-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,47
631-[6-(2,6-диметилфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,714
641-(5,7-дифтор-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,622
651-[4-оксо-6-(пиридин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота; 7,642
661-(4-оксо-7-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,241
67соль 1-[4-оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновой кислоты и трис(гидроксиметил)аминометана; 7,818
68 1-(7-хлор-4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,759

691-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;8,157
701-(6-дифенил-3-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,541
711-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,816
721-[6-(4-трет-бутил-бензолсульфонил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,322
731-(7,7-диметил-4-оксо-3,7-дигидро-4Н-8-окса-1,3-диазаантрацен-2-ил)-1Н-пиразол-4-карбоновая кислота;7,788
741-(4-оксо-6-феноксиметил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,535
751-[6-(2,6-диметилфеноксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,720
761-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,516
771-[6-(1-хлорвинил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,627

781-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,45
791-[7-(4-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,46
801-[7-(2-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,55
811-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,126
821-[7-(4-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,215
831-[7-(2-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;711
841-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7101
851-[6-(7-бром-3,4-дигидро-1Н-изохинолин-2-ил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,649
86(рац)-1-{7-хлор-6-[3-(3-метоксифенил)-пиперидин-1- 7,671

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 ил]-4-оксо-3,4-дигидрохиназолин-2-ил}-1H-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
87 1-[6-(2,5-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,784
881-[6-(3,4-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,895
891-[6-(3,5-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,6137
901-[6-(2,5-дихлорфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,6113
911-[6-(дифенил-3-илокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,675
921-[6-(3,4-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7137
931-[7-метил-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7153
941-[6-(3,5-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,790

951-[7-фтор-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,761
961-[6-(2-фтор-3-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,651
971-[6-(3-фтор-5-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,737
981-[6-(3,5-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,785
991-[6-(дифенил-3-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,681
1001-[4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,655
1011-[6-(2,6-дихлорфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,624
1021-(6-циклогексилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,759
1031-[6-(4-метилпиперазин-1-ил)- 7,230

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
104 1-(6-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,575
1051-(6-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,5129
1061-(4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,5129
1071-(6-морфолин-4-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,445
1081-[6-(1Н-индол-6-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота; 7,685
1091-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,6100
1101-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,847
1111-(4-оксо-8-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,924
1121-(4-оксо-8-фенокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,818
1131-(4-оксо-8-фенилсульфанил- 6,717

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
114 1-(8-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,616
1151-(8-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,827
1161-(5,8-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,717
1171-(4-оксо-8-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,112
1181-(8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,116
1191-(6-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,8115
1201-(6-втор-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,768
1211-(6-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;830
1221-(6-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,616
1231-(4-оксо-6-пирролидин-1-ил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,417

1241-(4-оксо-6-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,471
1251-(6-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,319
1261-(4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,29
1271-(6-бром-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,59
1281-(6-этил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,453
1291-(4-оксо-6-пропил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,594
1301-(6-бром-8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,112
1311-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,221
1321-(5,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,916
1331-(7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,410
1341-(7-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,318
1351-(7-метокси-4-оксо-3,4- 7,117

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
136 1-(7-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,523
1371-(4-оксо-3,4,8,9-тетрагидро-7H-6,10-диокса-1,3-диазациклогепта[b]нафталин-2-ил)-1H-пиразол-4-карбоновая кислота;7,315
1381-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновая кислота;6,640
1391-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,4515
1401-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота;7,4562
1411-(6-оксо-2,3,6,7-тетрагидро-1H-7,9-диазациклопента[a]нафталин-8-ил)-1H-пиразол-4-карбоновая кислота;6,325
1421-(4-оксо-3,4,7,8,9,10-гексагидробензо[h]хиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,623
1431-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновая кислота;7,575

1441-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1Н-пиразол-4-карбоновая кислота;7,442
1451-(5,7-диметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,416
1461-(7-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,916
1471-(7-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,411
1481-(4-оксо-7-трифторметокси-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,910
1491-(7-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,49
1501-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,824
1511-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,211
1521-(7-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;6,838
1531-(6-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,422
1541-(7-гидрокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н- 7,312

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 пиразол-4-карбоновая кислота; хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
155 1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,540
1561-(4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,519
1571-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,517
1581-(7-хлор-6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,415
1591-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,616
1601-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,413
1611-[4-оксо-6-(пирролидин-1-сульфонил)-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;7,417
1621-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;7,515
1631-[6-(2,6-диметилфенилкарбамоил)-4- 7,414

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 оксо-3,4-дигидро-хиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
164 1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,617
1651-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,619
1661-[6-(2,6-диметилбензоиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,511
1671-(6-ацетиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,526
1681-[4-оксо-6-(3-фенилуреидо)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,54
1691-(6-бензолсульфониламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,634
1701-(6-метансульфонамино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,515
1711-(6-бензиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,634
1721-(6-этиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,620

1731-[6-(2-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7101
1741-[6-(2-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7.724
1751-[6-(2,6-диметилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,597
1761-[6-(2,6-дифторбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,426
1771-[6-(2-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,313
1781-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,712
1791-[6-(3-карбамоилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,612
1801-(6-амино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,28
1811-[6-(2,6-дихлорбензиламино)-4-оксо-3,4-дигидрохиназолин- 7,6118

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 2-ил]-1H-пиразол-4-карбоновая кислота; хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
182 1-[6-(3-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,626
1831-[6-(4-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,889
1841-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,112
1851-[7-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;715
1861-[7-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,326
1871-[7-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,224
1881-(4-оксо-7-о-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,111
1891-(4-оксо-7-м-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,325
1901-(4-оксо-6-м-толил-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,691
1911-(4-оксо-6-п-толил-3,4- 7,731

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
192 1-[6-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,587
1931-[6-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,5141
1941-[6-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,762
1951-[6-(2-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,6100
1961-[6-(3-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,492
1971-[6-(4-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7108
1981-[6-(2-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,7178
1991-[6-(3-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,6119
2001-[6-(4-метоксифенил)-4-оксо- 7,8118

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
201 1-[4-оксо-6-(2-трифторметилфенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,678
2021-[4-оксо-6-(2-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,829
2031-[6-(2-этилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,577
2041-[6-(2,3-дигидробензо[1,4]диоксин-5-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновая кислота;7,8111
2051-[4-оксо-6-(3-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,658
2061-[6-(3-метансульфонилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновая кислота;7,613
2071-(6-бензо[1,3]диоксол-5-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота;7,684
2081-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновая кислота.6,920

Гистология

Для гистологического анализа использовали различные животные модели. В одном из примеров оценивали эффект воздействия на собаку 1-[6-(2,6-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновой кислоты при пероральном введении через желудочный зонд в фазе исследования с увеличиваемой однократной дозировкой (Single Dose Escalation, SDE) и затем до 5 дней в фазе использования постоянной дозы. Результаты данного гистологического анализа приведены в Таблице 2 ниже.

Таблица 2
Орган10 мг/кг/сутки - 1001 (самец) 10 мг/кг/сутки - 1501 (самка)
ЛегкоеБЗП БЗП
Сердце БЗПБЗП
ПочкаНезначительное двустороннее острое многоочаговое воспаление; интерстициальная ткань таза

Незначительные тазовые минеральные отложения (правая почка)
БЗП
Печень Незначительное острое воспаление центральной доли с некрозом отдельных гепатоцитов Незначительное острое воспаление центральной доли

Незначительное острое портальное воспаление
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Незначительное острое портальное воспалениехиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

СелезенкаУмеренный ЭМГ с умеренным увеличением количества мегакариоцитов Умеренный ЭМГ с умеренным увеличением количества мегакариоцитов
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Незначительная коричневая пигментация внутри макрофаговНезначительная коричневая пигментация внутри макрофагов
Желудок БЗПБЗП
Семенник/ Эпидидимис БЗПхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
Костный мозг БЗПБЗП
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 45 мг/кг/сутки - 2001 (самец) 45 мг/кг/сутки - 2501 (самка)
ЛегкоеБЗП БЗП
Сердце БЗПхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
Почка Незначительное двустороннее острое многоочаговое воспаление; интерстициальная ткань тазаНезначительное двустороннее острое многоочаговое воспаление; интерстициальная ткань таза
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Множественные кисты с незначительным интерстициальным воспалением и базофильные канальцы Незначительная тубулярная вакуолизация
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Незначительная папиллярная минерализация почкихиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
Печень Умеренное острое воспаление и некроз центральной доли Умеренное острое воспаление и некроз центральной доли
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Умеренное острое портальное воспаление и некрозУмеренное острое портальное воспаление и некроз

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Умеренные изменения, апоптические и пикнотические клетки в синусоидахУмеренная гиперплазия желчных протоков

Многоочаговый тромбоз портальной зоны
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Умеренное многоочаговое расширение лимфатических сосудов портальной зоны Умеренные изменения, апоптические и пикнотические клетки в синусоидах

Незначительное расширение лимфатические сосудов портальной зоны

Незначительное осаждение коричневого пигмента в клетках Купфера
Селезенка Умеренный ЭМГУмеренный ЭМГ
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Умеренное увеличение количества мегакариоцитовУмеренное увеличение количества мегакариоцитов
хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412 Незначительная коричневая пигментация внутри макрофаговНезначительная коричневая пигментация внутри макрофагов
Желудок БЗПБЗП
Семенник/ Эпидидимис БЗПхиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412
Костный мозг БЗПБЗП
БЗП=без значительных повреждений, ЭМГ=экстрамедуллярный гемопоэз

Хотя раскрываемое изобретение было проиллюстрировано конкретными примерами и предпочтительными вариантами осуществления, должно быть понятно, что настоящее изобретение не ограничивается приведенным выше подробным описанием.

ФОРМУЛА ИЗОБРЕТЕНИЯ

1. Соединение формулы (I):

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

где:

n=от 0 до 3,

R1 представляет собой заместитель, независимо выбранный из группы, состоящей из галогена, -C1-4алкила, -C2-4 алкинила, -C2-4алкенила, необязательно замещенного галогеном, -CF3, -OCF3, SCF3 , S(O)CF3, -C(O)-Rc, -C(O)N-Rc , -OH, -NO2, -ОС1-4алкила; -SC1-4 алкила, -S(O)-C1-4алкила, -SO2-C1-4 алкила, -S-Rc, -S(O)-Rc, -SO2 -Rc, -O-Rc, -NRaRb , 2,3-дигидробензо[1,4]диоксина; бенз[1,3]диоксола; 1H-индола; бензила; бифенила, необязательно замещенного одним или более Rd, бензилокси, необязательно замещенного одним или более Rd, фенила, необязательно замещенного одним или более Rd, -C3-8циклоалкила, тетрагидропиранила, причем две смежные группы R1 могут быть соединены в виде 5-7-членного цикла, необязательно содержащего один или 2 гетероатома О или N, необязательно замещенного C1-4 алкильными группами;

Ra и Rb независимо выбраны из группы, состоящей из H, C1-4алкила, -C(O)C 1-4алкила, -C(O)-Rc, -C(O)NH-Rc, -SO2-Rc, -SO2-C1-4 алкила, фенила, необязательно замещенного Rd, бензила, необязательно замещенного Rd, или Ra и Rb вместе с несущим их атомом азота образуют необязательно замещенный C1-4алкилом 5-6-членный моноциклический гетероциклоалкил, содержащий один или 2 гетероатома О, S или N;

Rc представляет собой заместитель, независимо выбранный из группы, состоящей из -C3-8циклоалкила, пирролидино, бифенила, фенила, необязательно замещенного одним или более Rd, нафтила, инданила, 5,6,7,8-тетрагидронафтила и пиридила;

Rd представляет собой заместитель, независимо выбранный из группы, состоящей из -H, галогена, -C 1-4алкила, -SO2-C1-4алкила, -CN или -CF3, -OCF3, -OC1-4алкила, -C(O)NH 2;

и его фармацевтически приемлемые соли.

2. Соединение по п.1, в котором R1 независимо выбран из группы, состоящей из галогена, -C1-4алкила, -OCF 3, -CF3, -OH, NO2, -OC1-4 алкила, -SC1-4алкила, -S(O)-C1-4алкила, -SO2-C1-4алкила, -S-Rc, -S(O)-R c, -SO2-Rc, -O-Rc, -NR aRb, фенила, необязательно замещенного одним или более Rd, и -C3-8циклоалкила.

3. Соединение по п.1, в котором две смежные группы R1 объединены в 5-7-членный цикл, необязательно содержащий один или два O или N.

4. Соединение по п.1, в котором две смежные группы R1 объединены в 5-7-членный цикл, содержащий один или два О или N, необязательно замещенный C1-4 алкильными группами.

5. Соединение по п.1, в котором n=1.

6. Соединение по п.1, в котором n=2.

7. Соединение по п.1, в котором n=3.

8. Соединение по п.1, в котором заместитель -Ra и -Rb независимо выбран из группы, состоящей из -H, -CH3, -CH2CH3 , бензоила, 2,6-диметилбензоила, ацетила, -C(O)NH-фенила, бензолсульфонила, метансульфонила, бензила, 2-метилбензила, 2-хлорбензила, 2-цианобензила, 3-цианобензила, 3-карбамоилбензила, 3-хлорбензила и 4-метилбензила.

9. Соединение по п.1, в котором Ra и Rb вместе с несущим их атомом азота образуют N-метилпиперазин-1-ил, пиперидинил, морфолин-4-ил и пирролидинил.

10. Соединение по п.1, в котором Rc независимо выбран из группы, состоящей из фенила, циклогексила, 4-трет-бутилфенила, 3,4-диметоксифенила, 2,6-диметилфенила, 3,4,5-триметоксифенила, нафталин-1-ила, 3-хлорфенила, 4-хлорфенила, 3-метоксифенила, 4-фторфенила, 2-фторфенила, 3-фторфенила, 3,5-ди-трет-бутилфенила, 2,6-дихлорфенила, 2,4-дихлорфенила, 2,5-дихлорфенила, 4-метоксифенила, 2,6-диметилфенила, нафталин-2-ила, 5,6,7,8-тетрагидронафталин-1-ила, 4-хлорфенила, п-толила, индан-5-ила, 2,3-дихлорфенила и пиридин-3-ила.

11. Соединение по п.1, в котором Rd независимо выбран из группы, состоящей из -H, хлора, фтора, брома, иода, -C1-4алкила, -CF 3, -OCF3 или -OC1-4алкила.

12. Соединение по п.1, в котором R1 независимо выбран из группы, состоящей из хлора, фтора, брома, иода, -NO2 , -OH, -CF3, -CH3, -CH2CH 3, -CH2CH2CH3, -OCF 3, -OCH3, -OCH2CH3, -SCH 3, -SCF3, -S(O)CF3, -SO2 CH3, -NH2, -N(CH3)2 , -NH(CH2CH3), изопропокси, изопропила, втор-бутила, трет-бутила, этинила, 1-хлорвинила, пирролидин-1-карбонила, фенила, бензила, бифенила, толила, фенокси, циклопропила, циклогексила, фенилсульфанила, 3,4-диметоксифенилсульфанила, 4-трет-бутил-фенилсульфанила, 2,6-диметилфенокси, 3,4,5-триметоксифеноксиа, нафталин-1-илокси, нафталин-2-илокси, 5,6,7,8-тетрагидронафталин-1-илокси, индан-5-илокси, 3-хлорфенокси, 4-хлорфенокси, 2,3-дихлорфенокси, 3-метоксифенокси, 4-фторфенокси, 2-фторфенокси, 3-фторфенокси, 3,5-ди-трет-бутилфенокси, 3-метилфенокси, 2,6-дихлорфенокси, 2,5-дихлорофенокси, 4-метоксифенокси, пиридин-3-илокси, тетрагидропиран-4-ила и бензолсульфонила.

13. Соединение, выбранное из группы, состоящей из:

1-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-трифторметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-трифторметил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,6,7-триметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-циклогексил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-8-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(1-оксо-2,7-дигидро-1H-пирроло[3,2-f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-трет-бутилфенилсульфанил)-7-хлор-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-6-фенилсульфанил-1,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(3,4-диметоксифенилсульфанил)-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты.

1-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3,4,5-триметоксифенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-ди-трет-бутилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-м-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-о-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновой кислоты;

1-[6-(2,4-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,5-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-п-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(индан-5-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-метил-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,3-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-метокси-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(5,7-дифтор-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(пиридин-3-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

соли 1-[4-оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты и трис(гидроксиметил)аминометана;

1-(7-хлор-4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-дифенил-3-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-трет-бутилбензолсульфонил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7,7-диметил-4-оксо-3,7-дигидро-4Н-8-окса-1,3-диазаантрацен-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-феноксиметил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфеноксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(1-хлорвинил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-(4-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(2-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-(4-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(2-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(7-бром-3,4-дигидро-1H-изохинолин-2-ил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

(рац)-1-{7-хлор-6-[3-(3-метоксифенил)-пиперидин-1-ил]-4-оксо-3,4-дигидрохиназолин-2-ил}-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,5-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,4-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,5-дихлорфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(дифенил-3-илокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,4-диметил-фенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-метил-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-фтор-3-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-фтор-5-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(дифенил-3-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-циклогексилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метилпиперазин-1-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-морфолин-4-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(1H-индол-6-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,8-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-втор-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-пирролидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бром-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-этил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-пропил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бром-8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,8,9-тетрагидро-7H-6,10-диокса-1,3-диазациклогепта[b]нафталин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-4,6,7,8-тетрагидро-3H-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-оксо-2,3,6,7-тетрагидро-1H-7,9-диазациклопента[а]нафталин-8-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,7,8,9,10-гексагидробензо[h]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,7-диметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-гидрокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-6-трифторметансульфинил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(пирролидин-1-сульфонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенилкарбамоил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты

1-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилбензоиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-ацетиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3-фенилуреидо)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-бензолсульфониламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метансульфонамино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-этиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дифторбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-карбамоилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-амино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-м-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-м-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-п-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(2-трифторметилфенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(2-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-этилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,3-дигидробензо[1,4]диоксин-5-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-метансульфонилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-бензо[1,3]диоксол-5-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензолсульфинил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензолсульфонил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты; и

1-(4-оксо-7-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты; и их фармацевтически приемлемых солей.

14. Фармацевтическая композиция, обладающая ингибиторной активностью по отношению к PHD, содержащая фармацевтически приемлемый наполнитель и эффективное количество соединения формулы (I):

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

где:

n=от 0 до 3,

R1 представляет собой заместитель, независимо выбранный из группы, состоящей из галогена, -C1-4алкила, -C2-4 алкинила, -C2-4алкенила, необязательно замещенного галогеном, -CF3, -OCF3, -SCF3 , S(O)CF3, -C(O)-Rc, -C(O)N-Rc , -OH, -NO2, -OC1-4алкила, -SC1-4 алкила, -S(О)-C1-4алкила, -SO2-C1-4 алкила, -S-Rc, -S(O)-Rc, -SO2 -Rc, -O-Rc, -NRaRb , 2,3-дигидробензо[1,4]диоксина; бенз[1,3]диоксола; 1Н-индола; бензила; бифенила, необязательно замещенного одним или более Rd, бензилокси, необязательно замещенного одним или более Rd, фенила, необязательно замещенного одним или более Rd, -С3-8циклоалкила, тетрагидропиранила, причем две смежные группы R1 могут быть соединены в виде 5-7-членного цикла, необязательно содержащего один или 2 гетероатома О или N, необязательно замещенного C1-4 алкильными группами;

Ra и Rb независимо выбраны из группы, состоящей из H, C1-4алкила, -С(О)С 1-4алкила, -C(O)-Rc, -C(O)NH-Rc, -SO2-Rc, -SO2-C1-4 алкила, фенила, необязательно замещенного Rd, бензила, необязательно замещенного Rd, или Ra и Rb вместе с несущим их атомом азота образуют необязательно замещенный C1-4алкилом 5-6-членный моноциклический гетероциклоалкил, содержащий один или 2 гетероатома О, S или N;

Rc представляет собой заместитель, независимо выбранный из группы, состоящей из -C3-8циклоалкила, пирролидино, бифенила, фенила, необязательно замещенного одним или более Rd, нафтила, инданила, 5,6,7,8 -тетрагидронафтила и пиридила;

Rd представляет собой заместитель, независимо выбранный из группы, состоящей из -H, галогена, -C 1-4алкила, -SO2-C1-4алкила, -CN или -CF3, -OCF3, -OC1-4алкила, -C(O)NH 2;

или его фармацевтически приемлемой соли.

15. Фармацевтическая композиция, обладающая ингибиторной активностью по отношению к PHD, содержащая одно или более соединений, выбранных из группы, состоящей из:

1-(7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-трифторметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-метил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-трифторметил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6,7-диметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,6,7-триметокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-циклогексил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-6-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(1-оксо-2,7-дигидро-1H-пирроло[3,2-f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-трет-бутилфенилсульфанил)-7-хлор-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-6-фенилсульфанил-1,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(3,4-диметоксифенилсульфанил)-4-оксо-1,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3,4,5-триметоксифенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-ди-трет-бутилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-м-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-о-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,4-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,5-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метоксифенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-п-толилокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(4-хлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(2,6-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(нафталин-2-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-4-оксо-6-(5,6,7,8-тетрагидронафталин-1-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(3-фторфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(нафталин-1-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-6-(индан-5-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-метил-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,3-дихлорфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-метокси-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(5,7-дифтор-4-оксо-6-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(пиридин-3-илокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

соли 1-[4-оксо-7-(тетрагидропиран-4-ил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты и трис(гидроксиметил)аминометана;

1-(7-хлор-4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-дифенил-3-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(3,4-диметоксибензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-трет-бутилбензолсульфонил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7,7-диметил-4-оксо-3,7-дигидро-4Н-8-окса-1,3-диазаантрацен-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-феноксиметил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфеноксиметил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-этинил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(1-хлорвинил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-(4-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(2-хлорфенилсульфанил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(7-бензолсульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-(4-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(2-хлорбензолсульфонил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-хлор-6-(3,4-дигидро-1H-изохинолин-2-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(7-бром-3,4-дигидро-1H-изохинолин-2-ил)-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

(рац)-1-{7-хлор-6-[3-(3-метоксифенил)-пиперидин-1-ил]-4-оксо-3,4-дигидрохиназолин-2-ил}-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,5-дихлорфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,4-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,5-дихлорфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(дифенил-3-илокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,4-диметилфенокси)-7-метил-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-метил-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-диметилфенокси)-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-фтор-4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-фтор-3-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-фтор-5-трифторметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3,5-диметилфенокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(дифенил-3-илокси)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3-трифторметилфенокси)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорфенокси)-5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-циклогексилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метилпиперазин-1-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-морфолин-4-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(1Н-индол-6-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-циклопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-циклогексил-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-фенокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-фенилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,8-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-8-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-втор-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-пирролидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бром-7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-этил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-пропил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бром-8-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,7-дифтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,7-дихлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-фтор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-бром-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-метокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-бензил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,8,9-тетрагидро-7Н-6,10-диокса-1,3-диазациклогепта[b]нафталин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(8-оксо-2,3,7,8-тетрагидро-1,4-диокса-5,7-диазафенантрен-6-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,7,8-тетрагидро-[1,4]диоксино[2,3-g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-4,6,7,8-тетрагидро-3Н-циклопента[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-оксо-2,3,6,7-тетрагидро-1H-7,9-диазациклопента[а]нафталин-8-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,7,8,9,10-гексагидробензо[h]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-3,4,6,7,8,9-гексагидробензо[g]хиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(1-оксо-1,2,7,8,9,10-гексагидробензо[f]хиназолин-3-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5,7-диметил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-изопропил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-трет-бутил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-трифторметокси-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-изопропилокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(5-диметиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-этокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-гидрокси-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-метансульфонил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-6-метилсульфанил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-6-трифторметилсульфанил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-хлор-4-оксо-6-трифторметансульфинил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(пирролидин-1-сульфонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(пирролидин-1-карбонил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилфенилкарбамоил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-нитро-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты

1-(6-бензоиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилбензоиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-ацетиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3-фенилуреидо)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-бензолсульфониламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1Н-пиразол-4-карбоновой кислоты;

1-(6-метансульфонамино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-этиламино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-диметилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дифторбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-цианобензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-карбамоилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-амино-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,6-дихлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-хлорбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метилбензиламино)-4-оксо-3,4-дигидрохиназолин-2-ил]-1Н-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-фенил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[7-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[7-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-о-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-м-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-м-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-6-п-толил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-хлорфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-фторфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(4-метоксифенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(2-трифторметилфенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(2-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2-этилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(2,3-дигидробензо[1,4]диоксин-5-ил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[4-оксо-6-(3-трифторметоксифенил)-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-[6-(3-метансульфонилфенил)-4-оксо-3,4-дигидрохиназолин-2-ил]-1H-пиразол-4-карбоновой кислоты;

1-(6-бензо[1,3]диоксол-5-ил-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(7-иод-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензолсульфинил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(6-бензолсульфонил-7-хлор-4-оксо-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты;

1-(4-оксо-7-пиперидин-1-ил-3,4-дигидрохиназолин-2-ил)-1H-пиразол-4-карбоновой кислоты, и их фармацевтически приемлемых солей.

16. Способ лечения патологического состояния, выбранного из группы, состоящей из анемии, гипоксии, ишемии, заболеваний периферических сосудов, инфаркта миокарда, инсульта, диабета, ожирения, воспалительных заболеваний кишечника, неспецифического язвенного колита, болезни Крона, ран, инфекций, ожогов и перелома кости; причем указанный способ включает стадию введения пациенту, нуждающемуся в лечении, терапевтически эффективного количества соединения формулы (I), обладающего ингибиторной активностью по отношению к PHD:

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

где

n=от 0 до 3,

R1 представляет собой заместитель, независимо выбранный из группы, состоящей из галогена, -C1-4алкила, -C2-4 алкинила, -C2-4алкенила, необязательно замещенного галогеном, -CF3, -OCF3, SCF3 , S(O)CF3, -C(O)-Rc, -C(O)N-Rc , -OH, -NO2, -OC1-4алкила, -SC1-4 алкила, -S(O)-C1-4алкила, -SO2-C1-4 алкила, -S-Rc, -S(O)-Rc, -SO2 -Rc, -O-Rc, -NRaRb , 2,3-дигидробензо[1,4]диоксина; бенз[1,3]диоксола; 1Н-индола; бензила; бифенила, необязательно замещенного одним или более Rd, бензилокси, необязательно замещенного одним или более Rd, фенила, необязательно замещенного одним или более Rd, -C3-8циклоалкила, тетрагидропиранила, причем две смежные группы R1 могут быть соединены в виде 5-7-членного цикла, необязательно содержащего один или 2 гетероатома О или N, необязательно замещенного C1-4 алкильными группами;

Ra и Rb независимо выбраны из группы, состоящей из Н, C1-4алкила, -С(О)C 1-4алкила, -C(O)-Rc, -C(O)NH-Rc, -SO2-Rc, -SO2-C1-4 алкила, фенила, необязательно замещенного Rd, бензила, необязательно замещенного Rd, или Ra и Rb вместе с несущим их атомом азота образуют необязательно замещенный C1-4алкилом 5-6-членный моноциклический гетероциклоалкил, содержащий один или 2 гетероатома О, S или N;

Rc представляет собой заместитель, независимо выбранный из группы, состоящей из -C3-8циклоалкила, пирролидино, бифенила, фенила, необязательно замещенного одним или более Rd, нафтила, инданила, 5,6,7,8-тетрагидронафтила и пиридила;

Rd представляет собой заместитель, независимо выбранный из группы, состоящей из -Н, галогена, -C 1-4алкила, -SO2-C1-4алкила, -CN или -CF3, -OCF3, -OC1-4алкила, -C(O)NH 2;

и его фармацевтически приемлемой соли.

17. Способ лечения гипоксического расстройства, включающий стадии введения пациенту, нуждающемуся в лечении, терапевтически эффективного количества соединения формулы (I), обладающего ингибиторной активностью по отношению к PHD:

хиназолиноны как ингибиторы пролилгидроксилазы, патент № 2528412

где:

n=от 0 до 3,

R1 представляет собой заместитель, независимо выбранный из группы, состоящей из галогена, -C1-4алкила, -C2-4 алкинила, -C2-4алкенила, необязательно замещенного галогеном, -CF3, -OCF3, SCF3 , S(O)CF3, -C(O)-Rc, -C(O)N-Rc , -OH, -NO2, -OC1-4алкила, -SC1-4 алкила, -S(O)-C1-4алкила, -SO2-C1-4 алкила, -S-Rc, -S(O)-Rc, -SO2 -Rc, -O-Rc, -NRaRb , 2,3-дигидробензо[1,4]диоксина; бенз[1,3]диоксола; 1Н-индола; бензила; бифенила, необязательно замещенного одним или более Rd, бензилокси, необязательно замещенного одним или более Rd, фенила, необязательно замещенного одним или более Rd, -C3-8циклоалкила, тетрагидропиранила, причем две смежные группы R1 могут быть соединены в виде 5-7-членного цикла, необязательно содержащего один или 2 гетероатома О или N, необязательно замещенного C1-4 алкильными группами;

Ra и Rb независимо выбраны из группы, состоящей из Н, C1-4алкила, -C(O)C 1-4алкила, -C(O)-Rc, -C(O)NH-Rc, -SO2-Rc, -SO2-C1-4 алкила, фенила, необязательно замещенного Rd, бензила, необязательно замещенного Rd, или Ra и Rb вместе с несущим их атомом азота образуют необязательно замещенный C1-4алкилом 5-6-членный моноциклический гетероциклоалкил, содержащий один или 2 гетероатома О, S или N;

Rc представляет собой заместитель, независимо выбранный из группы, состоящей из -C3-8циклоалкила, пирролидино, бифенила, фенила, необязательно замещенного одним или более Rd, нафтила, инданила, 5,6,7,8-тетрагидронафтила и пиридила;

Rd представляет собой заместитель, независимо выбранный из группы, состоящей из -H, галогена, -C 1-4алкила, -SO2-C1-4алкила, CN или -CF3, -OCF3, -OC1-4алкила, -C(O)NH 2;

или его фармацевтически приемлемой соли.

18. Способ по п.17, в котором указанное гипоксическое расстройство выбрано из группы, состоящей из анемии, ишемии, инсульта, инфаркта миокарда и ишемической болезни сердца.

19. Способ лечения диабета, включающий введение терапевтически эффективного количества соединения по п.1 нуждающемуся в лечении пациенту.

20. Способ лечения ран, включающий введение терапевтически эффективного количества соединения по п.1 нуждающемуся в лечении пациенту.

21. Способ лечения нарушения обмена веществ, включающий введение терапевтически эффективного количества соединения по п.1 нуждающемуся в лечения пациенту.

22. Способ по п.21, в котором указанное нарушение обмена веществ представляет собой ожирение или диабет.


Скачать патент РФ Официальная публикация
патента РФ № 2528412

patent-2528412.pdf
Патентный поиск по классам МПК-8:

Класс C07D403/04 связанные непосредственно

Патенты РФ в классе C07D403/04:
сп0соб получения соединений дигидроинденамида, фармацевтические композии, содержащие данные соединение и их применение в качестве ингибитора протеинкиназы -  патент 2528408 (20.09.2014)
новое производное пиразол-3-карбоксамида, обладающее антагонистической активностью в отношении рецептора 5-нт2в -  патент 2528406 (20.09.2014)
производные имидазола в качестве антагонистов mglur5 -  патент 2527106 (27.08.2014)
соединения азаазулена -  патент 2524202 (27.07.2014)
замещенные аминоинданы и их аналоги, и их применение в фармацевтике -  патент 2522586 (20.07.2014)
алкил [2-(2-{5-[4-(4-{2-[1-(2-метоксикарбониламино-ацетил)-пирролидин-2-ил]-3н-имидазол-4-ил}-фенил)-бута-1,3-диинил]-1н-имидазол-2-ил}-пирролидин-1-ил)-2-оксо-этил]-карбамат, фармацевтическая композиция, лекарственное средство, способ лечения вирусных заболеваний -  патент 2518369 (10.06.2014)
производные индола и бензоморфолина в качестве модулятора метаботропных глутаматных рецепторов -  патент 2517181 (27.05.2014)
5-членное гетероциклическое соединение и его применение для лекарственных целей -  патент 2515968 (20.05.2014)
1н-хиназолин-2,4-дионы -  патент 2509764 (20.03.2014)
низкомолекулярные модуляторы активности trp-p8 -  патент 2509079 (10.03.2014)

Класс C07D401/14 содержащие три или более гетероциклических кольца

Патенты РФ в классе C07D401/14:
модулирующие jak киназу хиназолиновые производные и способы их применения -  патент 2529019 (27.09.2014)
новое производное пиразол-3-карбоксамида, обладающее антагонистической активностью в отношении рецептора 5-нт2в -  патент 2528406 (20.09.2014)
изоиндолиновые соединения для применения при лечении рака -  патент 2527952 (10.09.2014)
производные имидазола в качестве антагонистов mglur5 -  патент 2527106 (27.08.2014)
диаминогетероциклическое карбоксамидное соединение -  патент 2526253 (20.08.2014)
тозилатная соль производного 5-пиразолил-2-пиридона, полезная в лечении copd -  патент 2526038 (20.08.2014)
антибактериальные соединения -  патент 2525915 (20.08.2014)
соединения, которые являются ингибиторами erk -  патент 2525389 (10.08.2014)
соединения азаазулена -  патент 2524202 (27.07.2014)
хиназолинон, хинолон и родственные аналоги в качестве модуляторов сиртуина -  патент 2519779 (20.06.2014)

Класс C07D405/14 содержащие три или более гетероциклических кольца

Патенты РФ в классе C07D405/14:
модулирующие jak киназу хиназолиновые производные и способы их применения -  патент 2529019 (27.09.2014)
изоиндолиновые соединения для применения при лечении рака -  патент 2527952 (10.09.2014)
аналоги хроменона в качестве модуляторов сиртуина -  патент 2527269 (27.08.2014)
замещенные пиридазин-карбоксамидные соединения в качестве соединений, ингибирующих киназы -  патент 2526618 (27.08.2014)
диаминогетероциклическое карбоксамидное соединение -  патент 2526253 (20.08.2014)
соединения азаазулена -  патент 2524202 (27.07.2014)
алкил [2-(2-{5-[4-(4-{2-[1-(2-метоксикарбониламино-ацетил)-пирролидин-2-ил]-3н-имидазол-4-ил}-фенил)-бута-1,3-диинил]-1н-имидазол-2-ил}-пирролидин-1-ил)-2-оксо-этил]-карбамат, фармацевтическая композиция, лекарственное средство, способ лечения вирусных заболеваний -  патент 2518369 (10.06.2014)
новое бициклическое гетероциклическое соединение -  патент 2518073 (10.06.2014)
5-членное гетероциклическое соединение и его применение для лекарственных целей -  патент 2515968 (20.05.2014)
производные 8-оксихинолина в качестве модуляторов рецептора в2 брадикинина -  патент 2512541 (10.04.2014)

Класс C07D487/04 орто-конденсированные системы

Патенты РФ в классе C07D487/04:
5-метил-6-нитро-7-оксо-4,7-дигидро-1,2,4-триазоло[1,5-альфа]пиримидинид l-аргининия моногидрат -  патент 2529487 (27.09.2014)
новое производное пиразол-3-карбоксамида, обладающее антагонистической активностью в отношении рецептора 5-нт2в -  патент 2528406 (20.09.2014)
6-замещенные 3-азолилимидазо[1,2-b][1,2,4,5]тетразины, проявляющие противоопухолевую активность -  патент 2527258 (27.08.2014)
гетероциклические соединения и способы применения -  патент 2525116 (10.08.2014)
соединения азаазулена -  патент 2524202 (27.07.2014)
замещенные пиразоло[1,5-a]пиримидиновые соединения как ингибиторы трк киназы -  патент 2523544 (20.07.2014)
соли производных тетерагидро-имидазо[1,5-a]пиразина, способы их получения и их медицинское применение -  патент 2523543 (20.07.2014)
замещенные аминоинданы и их аналоги, и их применение в фармацевтике -  патент 2522586 (20.07.2014)
способы и композиции для стимулирования нейрогенеза и ингибирования дегенерации нейронов с использованием изотиазолопиримидинонов -  патент 2521333 (27.06.2014)
кристаллические соли ситаглиптина -  патент 2519717 (20.06.2014)

Класс C07D491/056 с двумя или более атомами кислорода в качестве гетероатомов в кислородсодержащем кольце

Патенты РФ в классе C07D491/056:
производные 5-амино-2-(1-гидроксиэтил)тетрагидропирана -  патент 2525541 (20.08.2014)
нестероидные противовоспалительные средства на основе производных пиридоксина -  патент 2513089 (20.04.2014)
производные пиридоксина с нелинейными оптическими свойствами -  патент 2501801 (20.12.2013)
новый моногидрат производного нафтиридина и способ его получения -  патент 2485127 (20.06.2013)
производное (аза)индола и его применение в лечебных целях -  патент 2477274 (10.03.2013)
полициклические производные индазола и их применение в качестве ингибиторов erk для лечения рака -  патент 2475484 (20.02.2013)
производное пиперидина -  патент 2470020 (20.12.2012)
замещенные пиразолопиримидины, способ их получения и их применение в качестве лекарственного средства -  патент 2450004 (10.05.2012)
циклоалкиламины в качестве ингибиторов повторного поглощения моноамина -  патент 2430913 (10.10.2011)
производные тетрагидронафтиридина и способ их получения -  патент 2356902 (27.05.2009)

Класс A61K31/517  орто- или пери- конденсированные с карбоциклическими системами, например хиназолин, перимидин

Патенты РФ в классе A61K31/517:
модулирующие jak киназу хиназолиновые производные и способы их применения -  патент 2529019 (27.09.2014)
комбинации ингибиторов фосфоинозитид 3-киназы и химиотерапевтических агентов и способы применения -  патент 2523890 (27.07.2014)
соединения, ингибирующие (блокирующие) горький вкус, способы их применения и получения -  патент 2522456 (10.07.2014)
гидроксилированный пиримидил циклопентан в качестве ингибитора протеинкиназы (акт) -  патент 2520735 (27.06.2014)
хиназолинон, хинолон и родственные аналоги в качестве модуляторов сиртуина -  патент 2519779 (20.06.2014)
комбинации конъюгата анти-her2-антитело-лекарственное средство и химиотерапевтических средств и способы применения -  патент 2510272 (27.03.2014)
1н-хиназолин-2,4-дионы -  патент 2509764 (20.03.2014)
феноксипиридиниламидные производные и их применение в лечении pde4-опосредованных болезненных состояний -  патент 2509077 (10.03.2014)
положительные аллостерические модуляторы м1-рецепторов на основе пираниларилметилбензохиназолинона -  патент 2507204 (20.02.2014)
производные хиназолина, обладающие антидепрессивной, анксиолитической и ноотропной активностью -  патент 2507199 (20.02.2014)

Класс A61K31/519  орто- или пери-конденсированные с гетероциклическими кольцами

Патенты РФ в классе A61K31/519:
цитрат 11-(2-пирролидин-1-ил-этокси)-14,19-диокса-5,7,26-триазатетрацикло[19.3.1.1(2,6).1(8,12)]гептакоза-1(25),2(26),3,5,8,10,12(27),16,21,23-декаена -  патент 2527970 (10.09.2014)
гетероциклические соединения и способы применения -  патент 2525116 (10.08.2014)
способ коррекции тромбофилических нарушений гемостаза во время беременности -  патент 2524653 (27.07.2014)
производные тиено[3,2-d]пиримидина, обладающие ингибирующей активностью в отношении протеинкиназы -  патент 2524210 (27.07.2014)
комбинации ингибиторов фосфоинозитид 3-киназы и химиотерапевтических агентов и способы применения -  патент 2523890 (27.07.2014)
лекарственное средство, включающее совместное применение или комбинацию ингибитора dpp-iv и другого лекарственного средства для лечения диабета -  патент 2523552 (20.07.2014)
замещенные пиразоло[1,5-a]пиримидиновые соединения как ингибиторы трк киназы -  патент 2523544 (20.07.2014)
производное трициклического пиразолопиримидина -  патент 2520966 (27.06.2014)
способ лечения замедленной элиминации метотрексата после его высокодозной инфузии при опухолях головного мозга у детей -  патент 2516924 (20.05.2014)
пиримидопиридазиновые производные, пригодные в качестве р38 марк -  патент 2516466 (20.05.2014)

Класс A61P9/10 для лечения ишемических или атеросклеротических заболеваний, например антиангинозные средства, коронарные вазодилататоры, средства для лечения инфаркта миокарда, ретинопатии, цереброваскулярной недостаточности почечного артериосклероза

Патенты РФ в классе A61P9/10:
ингибиторы поли(адф-рибозо)полимеразы-1 человека на основе производных урацила -  патент 2527457 (27.08.2014)
средство, обладающее кардиопротекторным действием, и галогениды 1,3-дизамещенных 2-аминобензимидазолия -  патент 2526902 (27.08.2014)
способ проведения предупреждающего обезболивания у больных осложненным инфарктом миокарда -  патент 2526801 (27.08.2014)
производное сложного эфира тиенопиридина, содержащее цианогруппу, способ его получения, его применение и композиция на его основе -  патент 2526624 (27.08.2014)
средство для стимуляции васкуляризации сердечной мышцы при постинфарктном ее ремоделировании в эксперименте -  патент 2526466 (20.08.2014)
способ повышения фармакологической активности действующего вещества лекарственного средства и фармацевтическая композиция -  патент 2526153 (20.08.2014)
способ лечения больных облитерирующим атеросклерозом артерий нижних конечностей с сочетанной ибс -  патент 2525157 (10.08.2014)
способ раннего выявления высокого риска развития нарушения толерантности к глюкозе у больных стабильной стенокардией напряжения на фоне бета-адреноблокаторов без дополнительных вазодилатирующих свойств -  патент 2523691 (20.07.2014)
способ лечения хронической сердечной недостаточности и фармацевтическая композиция для лечения хронической сердечной недостаточности -  патент 2523451 (20.07.2014)
способ профликатики ранней послеоперационной когнитивной дисфункции у пациентов после коронарного шунтирования в условиях искуственного кровообращения -  патент 2523450 (20.07.2014)

Класс A61P3/10 для лечения гипергликемии, например антидиабетические средства

Патенты РФ в классе A61P3/10:
новый вариант эксендина и его конъюгат -  патент 2528734 (20.09.2014)
соли метил(r)-7-[3-амино-4-(2,4,5-трифторфенил)-бутирил]-3-трифторметил-5,6,7,8-тетрагидро-имидазо[1,5-a]пиразин-1-карбоксилата -  патент 2528233 (10.09.2014)
инсулин-олигомерные конъюгаты, их препараты и применения -  патент 2527893 (10.09.2014)
ингибиторы поли(адф-рибозо)полимеразы-1 человека на основе производных урацила -  патент 2527457 (27.08.2014)
аналоги хроменона в качестве модуляторов сиртуина -  патент 2527269 (27.08.2014)
способ повышения фармакологической активности действующего вещества лекарственного средства и фармацевтическая композиция -  патент 2526153 (20.08.2014)
способ комплексного лечения артериальной гипертонии при метаболических нарушениях -  патент 2525593 (20.08.2014)
способ коррекции ожирения абдоминального типа -  патент 2525007 (10.08.2014)
применение apl пептида для лечения воспалительной болезни кишечника и диабета типа 1 -  патент 2524630 (27.07.2014)
производные 2,3-дигидро-1н-инден-1-ил-2,7-диазаспиро[3.5]нонана и их применение в качестве антагонистов или обратных агонистов грелинового рецептора -  патент 2524341 (27.07.2014)

Класс A61P3/06 средства против повышенного содержания жира в крови (гиперлипемии)

Патенты РФ в классе A61P3/06:
антагонисты pcsk9 -  патент 2528735 (20.09.2014)
экстракт семян fraxinus excelsior и его терапевтическое применение -  патент 2523905 (27.07.2014)
способ профилактики и лечения нарушений обмена веществ по типу липидемии в сочетании с инсулиннезависимым сахарным диабетом методом питьевой бальнеотерапии с использованием природной минеральной галогенсодержащей воды -  патент 2523886 (27.07.2014)
способ лечения и повышения качества жизни больных с синдромом диспепсии в сочетании с ожирением -  патент 2523558 (20.07.2014)
фитокомплекс из плодов бергамота, способ производства и применение в качестве пищевой добавки и в области фармакологии -  патент 2523384 (20.07.2014)
замещенные аминоинданы и их аналоги, и их применение в фармацевтике -  патент 2522586 (20.07.2014)
соединение для лечения метаболических расстройств -  патент 2521284 (27.06.2014)
фармацевтическая композиция, средство для профилактики и лечения метаболического синдрома и диабетической нефропатии и способ его получения -  патент 2519744 (20.06.2014)
композиции и способы понижения уровня триглицеридов без повышения уровня хс-лпнп у субъекта, получающего сопутствующую терапию -  патент 2519043 (10.06.2014)
производное селеназола, имеющее лиганд, который активирует рецептор, активируемый пролифератором пероксисом ( ppar ), способ его получения и применение химических соединений -  патент 2510394 (27.03.2014)

Класс A61P43/00 Лекарственные средства для специфических целей, не указанные в группах  1/00

Патенты РФ в классе A61P43/00:
улучшение памяти у пациентов с оценкой 24-26 баллов по краткой шкале оценки психического статуса -  патент 2529815 (27.09.2014)
способ лечения больных с синдромом внутрипеченочной портальной гипертензии -  патент 2529414 (27.09.2014)
способ лечения ран мягких тканей различной этиологии -  патент 2528905 (20.09.2014)
новый агонист бета рецептора тиреоидного гормона -  патент 2527948 (10.09.2014)
стабильная жидкая фармацевтическая композиция комплекса 3-(2,2,2-триметилгидразиний) пропионат-2-этил-6-метил-3-гидроксипиридина дисукцината, обладающая антигипоксическим, антиоксидантным и адаптогенным действием -  патент 2527347 (27.08.2014)
четырехзамещенные бензолы -  патент 2527177 (27.08.2014)
способ коррекции негативных эффектов низких температур на предстательную железу крыс -  патент 2527172 (27.08.2014)
способ модулирования биологических функций, ассоциированных с процессом старения пожилого или старого животного-компаньона. -  патент 2525617 (20.08.2014)
гомографт сердечно-сосудистой системы (варианты), способ получения гомографта, среда для воздействия на ткани гомографта (варианты) -  патент 2525197 (10.08.2014)
способ коррекции нейротоксического действия дапсона, в эксперименте -  патент 2525180 (10.08.2014)


Наверх