Поиск патентов

способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli

Классы МПК:C12N15/70 векторы или системы экспрессий, специально приспособленные для Ecoli
C12N15/09 метод рекомбинантных ДНК
Автор(ы):, , , , , , , , , ,
Патентообладатель(и):Федеральное государственное бюджетное учреждение "Институт полиомиелита и вирусных энцефалитов им. М.П. Чумакова" РАМН (RU)
подача заявки:
публикация патента:

Изобретение относится к области биотехнологии и касается способа получения рекомбинантного антигена G2 хантавирусов. Представленный способ характеризуется тем, что ДНК конструкции pGHF, кодирующая слитый белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с последовательностью аминокислот SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEWKDPDGMLKDHLNILVTKDIDFDT, а C-концевое - мини-домен фолдон фибритина колифага JS98C3 (фиг.2), вводят в клетки E.coli, культивируют трансформированные данной конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата центрифугированием, продукт экспрессии в форме телец включения солюбилизируют с помощью денатурата, проводят хроматографию и используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом. Представленное решение позволяет улучшить воспроизводимость и чувствительность иммуноферментного анализа при диагностике ГЛПС. 7 ил. способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805

Рисунки к патенту РФ 2509805

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805

Область техники, к которой относится изобретение: Изобретение относится к области биотехнологии, в частности, к получению рекомбинантного антигена G2 хантавирусов с характеристиками, позволяющими улучшить воспроизводимость и чувствительность иммуноферментного анализа при диагностике ГЛПС.

Уровень техники: геморрагическая лихорадка с почечным синдромом (ГЛПС) - вирусный нетрансмиссивный зооноз, занимает в России ведущее место по числу заболевших среди природно-очаговых инфекций.

Наиболее эффективным методом борьбы с ГЛПС является специфическая профилактика, то есть вакцинация населения эндемичных регионов [1-3]. В настоящее время коммерческие вакцины против ГЛПС производятся только в Китае, однако ни одна из этих вакцин не может применяться в европейских регионах России, так как не обеспечивает защиты от вирусов Пуумала и Добрава - возбудителей ГЛПС в этих регионах [4-7].

Для изготовления и контроля вакцины против вирусов Пуумала и Добрава необходимо решить проблему разработки эффективных серологических методов на основе белков внешней оболочки - энвелопа хантавирусов. Однако до настоящего времени задача получения полноразмерных коммерческих препаратов белков энвелопа G1 и G2 хантавирусов не решена нигде в мире, что обусловлено их токсичностью по отношению к бактериальным клеткам.

Недавно был получен рекомбинантный антиген НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 12, представляющий собой фрагмент белка G2 хантавируса Добрава, сохраняющий иммуногенность полноразмерного продукта, но не проявляющий токсичности по отношению к клеткам продуцента (пат. заявка RU № 2010141819 от 13.10.2010). При этом данный белок накапливался в клетках E.coli в виде телец включения [8-10]. Вследствие этого, при использовании антигена НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 12 в иммунологических тестах, необходимо проводить предварительную ренатурацию продукта, что в свою очередь негативно сказывается на чувствительности и воспроизводимости иммунологического теста.

Целью нашей работы является разработка способа повышения качественных характеристик антигена НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 12 за счет изменения его структуры.

Раскрытие изобретения: сущностью изобретения является способ повышения качественных характеристик рекомбинантного антигена G2 (НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 12) для его использования в иммунологических тестах при диагностике ГЛПС благодаря улучшению растворимости целевого белка-антигена G2 хантавируса Добрава за счет стабилизации его глобулярной структуры бета-структурным мини-доменом фолдона фибритина колифага JS98C3. Таким образом, настоящее изобретение относится к способу получения белка-антигена G2 хантавируса Добрава с заданными качественными характеристиками (белок GHF) для повышения воспроизводимости и чувствительности иммуноферментного анализа при диагностике ГЛПС. Способ предусматривает следующие стадии:

1) получение плазмидной конструкции pGHF, несущей трифункциональный слитой ген;

2) экспрессия и анализ выхода белка GHF;

3) хроматография белка GHF на колонке Sepharose 6 FF;

4) проведение иммунохимических тестов.

Краткое описание графических изображений:

Фиг.1. Плазмидная конструкция pGHF принципиальная схема.

Фиг.2. Последовательность трифункционального слитого гена, кодирующего производное пептида НТ, в составе конструкции pGHF.

- Последовательность гена GFP подчеркнута волнистой линией;

- Последовательность гена пептида НТ из состава кДНК вируса Добрава закрашена серым;

- Последовательность гена фолдона фибритина подчеркнута пунктиром;

Фиг.3. Электрофоретический анализ продуктов экспрессии конструкции pGHF в растворимой (1) и нерастворимой (2) фракции лизата клеток Е.coli JM109, затрансформированных конструкцией pGHF. Белки разделены в денатурирующем 15% ПААГ. На рисунке (а) показан общий белок (гель окрашен Coomassie Blue R-250), на рисунке (б) представлено свечение белка в геле под УФ-излучением.

Фиг.4. Хроматография белка GHF на колонке Sepharose 6 FF. Оптическая плотность при способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 =280 нм представлена на графике (1).

Пунктирными линиями обозначен диапазон фракций, содержащих белок GHF (В1-В8).

Фиг.5. Изучение антигенной активности белка GHF методом твердофазного иммуноферментного анализа. Планшеты активированы белками-антигенами GHF (а) и НК6 (б). Пулы сывороток крови больных ГЛПС (вирусы Добрава, Пуумала, Хантаан) и здоровых доноров использовали в разведении от 50 до 3200 раз с шагом 2 раза. На оси ординат указана величина А450 каждой точки за вычетом фона (контроль без добавления сыворотки человека). На графиках представлены реакции белков-антигенов с сыворотками крови больных ГЛПС (1) и с сыворотками крови здоровых доноров (2).

Осуществление изобретения:

Методология исследования:

1) получение конструкции pGHF,

2) экспрессия и анализ выхода белка GHF,

3) хроматография белка GHF,

4) проведение иммунохимических тестов.

1) Получение конструкции

Получение конструкции проводили по следующей схеме:

В ранее описанную конструкцию рЕТ-НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 12 (пат. заявка RU № 2010141819 от 13.10.2010), несущую ген пептида НТ, клонировали ген фолдона фибритина из конструкции pET-cd-32a [11]. При этом и векторную конструкцию рЕТ-НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 12 расщепляли по сайтам SpeI и, XhoI, а вставку из конструкции pET-cd-32a извлекали рестрикцией по сайтам XbaI и XhoI.

Далее в уникальный сайт XbaI полученной конструкции на базе вектора рЕТ23а вводили синтетический ДНК-дуплекс, составленный из заранее фосфорилированных олигонуклеотидов:



Далее полученную конструкцию на основе рЕТ23а использовали в качестве матрицы для ПЦР с уникальным праймером


и со стандартным праймером T7terminator.

Полученный продукт ПЦР длиной 600 п.н. расщепляли рестриктазами BglII и XholI и клонировали в вектор pGem3z, расщепленный по сайтам BamHI и SalI.

Вставку «НТ+ фолдон фибритина» из конструкции pGem3z извлекали рестрикцией по сайтам SacI и PstI и клонировали в экспрессионный вектор pQE30-GFP, содержащий ген зеленого флуоресцентного белка GFP на базе вектора pQE30 (Qiagen) [12] по тем же сайтам.

В составе конструкции (фиг.1 и 2) можно выделить следующие элементы:

- экспрессионный вектор pQE30 (Qiagen);

- ген зеленого флуоресцентного белка GFP (Evrogen);

- фрагмент полилинкера вектора pGem-3z (Promega);

- ген Ht из конструкции рЕТ-НТ-12;

- фрагмент полилинкера вектора pGem-3z (Promega);

- ген фолдона фибритина фага JS98C3 [11].

2) Экспрессия и анализ выхода белка

Конструкцию pGHF вводили в клетки штамма Е.coli JM109. Селекцию колоний осуществляли по двум параметрам: по ампицилиноустойчивости и по наличию зеленой флуоресцентной окраски колоний. Полученный продуцент культивировали при 30°С в жидкой среде (0,5% дрожжевой экстракт, 1% пептон, 0,5% NaCl) с добавлением 100 мкг/мл ампициллина в колбах Эрленмейера объемом 750 мл (30 мл среды на колбу) в течение 14-18 часов. Посевной материал представлял собой смыв культуры клеток с чашек с агаризованной средой (0,5% дрожжевой экстракт, 1% пептон, 1,5% агар, 0,5% NaCl), полученных высевом первичных трансформантов. Возраст трансформантов - около 40 часов с момента окончания трансформации, температура культивирования - 30°С. Доза засева - 5×108 клеток на колбу. Индукцию промотора в клетках продуцента проводили IPTG.

Оценку накопления целевого продукта в клетках Е.coli осуществляли с помощью электрофоретического анализа суммарных белков рекомбинантного продуцента по Лэммли. Для этого из грубого клеточного лизата каждой культуры отбирали по 100 мкл. Лизат подвергали центрифугированию при 14000 G. в течение 15 мин и разделяли растворимую и нерастворимую клеточную фракции. Белки солюбилизировали в 30 мкл буфере Лэммли и анализировали состав белков с помощью денатурирующего SDS-электрофореза в 15% ПААГ (фиг.3). Флуоресцентное свечение белков растворимой фракции в геле наблюдали в районе 47 кДа, что соответствует расчетной массе белка GHF. Белки нерастворимой фракции флуоресцентного свечения не имели.

3) Хроматография белка

Грубый клеточный лизат культуры JM109 (GHF) подвергали центрифугированию при 8000 G. в течение 1 часа и разделяли растворимую и нерастворимую клеточную фракции. Белок из растворимой фракции подвергали первоначальной очистке путем двойного высаливания сульфатом аммония. Первый осадок, полученный путем осаждения 1,2% раствором (NH)4 SO2, удаляли из фракции, последующий второй осадок (после осаждения 2% раствором (NH)4SO2), содержащий целевой белок GHF, собирали центрифугированием при 8000 G в течение 1 часа. Осадок суспендировали в 8 мл буфера (10 мМ Tris-HCl, 130 мМ NaCl, pH=7,8).

Основной целью хроматографии белка - производного пептида НТ в денатурирующих условиях являлось удаление примесей нуклеиновых кислот, формирующих коллоид с участием белков и препятствующих эффективному применению других методов хроматографии. При этом удаление из препарата примесей клеточных белков Е.coli рассматривалась лишь как побочная задача.

Полученный раствор белка GHF в объеме 15 мл наносили на колонку Sepharos 6 FF (GE Healthcare, США, высота 24 см, объем 48 мл), уравновешенную буфером А. Элюцию проводили линейным градиентом NaCl от 0 до 0,5 М в хроматографическом буфере В (Tris-HCl, 100 мМ) со скоростью 8 мл/мин (фиг.4).

Фракции для дальнейшей работы, содержащие целевой белок GHF, отбирали, оценивая присутствие флюоресцентной зеленой окраски в растворе. Отобранные фракции по 10 мл объемом каждая объединяли и подвергали концентрированию и очистке на HisLink Protein Purification Resin (Promega). Материал фракций белка GHF, полученный в результате, оказался иммунохимически чистым и электрофоретически гомогенным, что позволило непосредственно использовать его для проведения иммунохимических тестов.

4) Проведение иммунохимических тестов

В качестве формата проведения анализа был выбран вариант тИФА с непосредственной сорбцией рекомбинантного белка-антигена GHF на поверхность иммунологического планшета. Препаратом для сравнения служил белок-антиген НК6. В процессе сорбции белковые препараты GHF и НК6 разводили в 20-50 раз карбонат-бикарбонатным буфером (КГБ), доводя концентрацию общего белка в растворе до 10 мкг/мл. Полученный раствор вносили в иммунологические планшеты на 1 сутки, после чего проводили блокирование неспецифического связывания на подложке с помощью 1% БСА в буфере КГБ. На следующей стадии проведения анализа проводилось серийное титрование пулов сывороток крови больных ГЛПС и, в качестве сравнения, здоровых доноров. При этом пул сывороток крови включал больных ГЛПС, инфицированных вирусом Добрава, Пуумала и Хаантан. Сыворотки крови брали в разведении от 50 до 3200 раз с шагом 2 раза. В качестве контрольного образца использовали лунки планшета, в которые вместо разведенной сыворотки человека вносили буфер PBS («конъюгатный контроль»).

В заключение все лунки планшета обрабатывали антивидовым конюгатом против IgG человека, меченным пероксидазой, и субстратом ТМВ в присутствии пероксида водорода. Сигнал мерили на планшетном сканере-спектрофотометре при способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 =450 нм. Результаты определений представлены на фиг.5.

Полученные результаты доказывают, что повышение растворимости рекомбинантного антигена за счет изменения его структуры приводит к увеличению разрешающей способности иммунологического анализа для диагностики ГЛПС.

Список использованных источников

1. Maes P., Clement J., Van Ranst M. Recent approaches in hantavirus vaccine development. - Expert Rev Vaccines. - 2009 - V.8, № 1, P.67-76.

2. Cho H.W., Howard C.R., Lee H.W. Review of an inactivated vaccine against hantaviruses. - Intervirology. - 2002 - V.45, № 4-6, P.328-333.

3. Song G. Epidemiological progresses of hemorrhagic fever with renal syndrome in China. - Chin Med J (Engl). - 1999 - V.112, № 5, P.472-477.

4. Oya A. Japanese encephalitis vaccine. - Acta Paediatr Jpn. - 1988 - V.30, № 2, Р.175-184.

5. Choi Y. Ahn C.J., Seong K.M., Jung M.Y., Ahn B.Y. Inactivated Hantaan virus vaccine derived from suspension culture of Vero cells. - Vaccine. - 2003 - V.21, № 17-18, P.1867-1873.

6. Lee H.W., Chu Y. K., Woo Y.D. Immune responses after two or three doses of Hantavax vaccination against Hantaan virus // Proc. fifth international conference on hemorrhagic fever with renal syndrome, hantavirus pulmonary syndrome and hantaviruses. Lion, Franch - 2001. - P.234-242.

7. Ruan Y., Xu X., Liu Wспособ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 Deng X, Weng S, Zhou W, Wang Q, Chen L, Fang L, Xu Z, Yan Q, Liu W, Dong G, Gu H, Yu Y, Xu Z. A study on immunogenicity and safety of bivalent inactivated vaccine against hemorrhagic fever with renal syndrome. - Zhonghua Yu Fang Yi Xue Za Zhi. - 1999 - V.33, № 6, P.340-342.

8. Hooper J.W., Kamrud K.I., Elgh F., Custer D., Schmaljohn C.S. DNA vaccination with hantavirus M segment elicits neutralizing antibodies and protects against seoul virus infection. - Virology. - 1999 - V.255, № 2, P.269-278.

9. Kallio-Kokko H., Leveelahti R., Brummer-Korvenkontio M., Lundkvist A., Vaheri A., Vapalahti O. Human immune response to Puumala virus glycoproteins and nucleocapsid protein expressed in mammalian cells. - J Med Virol. - 2001 - V.65, № 3, P.605-613

10. Huang H., Li X., Zehua Z. Genetic immunization with Hantavirus vaccine combining expression of G2 glycoprotein and fused interleukin-2. - Genetic Vaccines and Therapy. - 2008 - V.6. - P.15-21.

11. Латыпов О.Р., Голомидова А.К., Летаров А.В. Характеристика продукта гена wac бактериофага JS98C3, близкородственного фагу JS98 // Вестник КГУ. 2007. Т.149. С.112-122.

12. Шевелев А.Б., Хоменков В.Г., Кузнецова Т.В., Ковалев Л.И., Лагодная Н.В. Создание продуцента миостатина в виде слитого белка с 6His-GFP на основе Е.coli и изучение его иммуногенности. Сборник статей «Медико-биологические технологии повышения работоспособности в условиях напряженных физических нагрузок». Министерство образования и науки Российской Федерации, Москва, 2004, С.140-150.

Фиг. 2

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e.coli, патент № 2509805


Способ получения рекомбинантного антигена G2 Хантавируса Добрава в клетках E.coli, характеризующийся тем, что ДНК конструкции pGHF, кодирующая слитый белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с последовательностью аминокислот SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEWKDPDGMLKDHLNILVTKDIDFDT, а C-концевое - мини-домен фолдон фибритина колифага JS98C3 (фиг.2), вводят в клетки E.coli, культивируют трансформированные данной конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата центрифугированием, продукт экспрессии в форме телец включения солюбилизируют с помощью денатурата, проводят хроматографию и используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом.

Скачать патент РФ Официальная публикация
патента РФ № 2509805

Патентный поиск по классам МПК-8:

Класс C12N15/70 векторы или системы экспрессий, специально приспособленные для Ecoli

Патенты РФ в классе C12N15/70:
рекомбинантная днк, кодирующая гранулоцитарный колониестимулирующий фактор человека (g-csf) и рекомбинантная плазмида рas017, обеспечивающая синтез g-csf в клетках escherichia coli -  патент 2529363 (27.09.2014)
рекомбинантная днк, кодирующая гибридный белок эпидермального фактора роста человека слитого последовательностью глутатион-s-трансферазы (gst-hegf) и рекомбинантная плазмида pas007, обеспечивающая синтез gst-hegf в клетках escherichia coli -  патент 2521515 (27.06.2014)
рекомбинантная плазмидная днк pg1-rm7, обеспечивающая синтез гибридного белка g1-rm7, и гибридный белок, связывающий фактор некроза опухолей и обладающий биолюминесцентной активностью -  патент 2513686 (20.04.2014)
рекомбинантная плазмидная днк pqe-p35d, обеспечивающая синтез рекомбинантного белка p35d вируса оспы коров, штамм бактерий escherichia coli - продуцент рекомбинантного белка p35d вируса оспы коров и рекомбинантный белок p35d вируса оспы коров, используемый для создания тест-систем и конструирования субъединичных вакцин против ортопоксвирусных инфекций -  патент 2511037 (10.04.2014)
рекомбинантный полипептид а2, селективно связывающий hsa, рекомбинантная днк pa2, кодирующая hsa-связывающую часть полипептида a2, его продуцент - рекомбинантный штамм escherichia coli m15-a2, содержащий рекомбинантную плазмидную днк pqe 32-pa2, обеспечивающую получение полипептида a2 и применение полипептида а2 для диагностики микроальбуминурии и выделения hsa из сыворотки крови -  патент 2506271 (10.02.2014)
способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e. coli -  патент 2495938 (20.10.2013)
система экспрессии компонентов ортогональной трансляции в эубактериальной клетке-хозяине -  патент 2467069 (20.11.2012)
штамм клеток e.coli bl21(de3)plyss, клон ptt9/asfvp30, содержащий рекомбинантную плазмиду со встройкой участка гена ср204l вируса африканской чумы свиней, кодирующего конформационный эпитоп белка p30, для изготовления диагностических препаратов -  патент 2463343 (10.10.2012)
рекомбинантная плазмидная днк pтв323, кодирующая гибридный полипептид gst-дельтамрт64 со свойствами видоспецифичного микобактериального антигена мрт64 (мрв64), рекомбинантный штамм бактерий escherichia coli - продуцент гибридного полипептида gst-дельтамрт64 и рекомбинантный полипептид gst-дельтамрт64 -  патент 2458130 (10.08.2012)
состав полиэпитопного белка для индукции иммунного ответа против вируса ящура -  патент 2453557 (20.06.2012)

Класс C12N15/09 метод рекомбинантных ДНК

Патенты РФ в классе C12N15/09:
рекомбинантная плазмидная днк ppa-oprf-eta, кодирующая синтез рекомбинантного белка oprf-eta pseudomonas aeruginosa, штамм escherichia coli pa-oprf-eta - продуцент рекомбинантного белка oprf-eta pseudomonas aeruginosa и способ получения рекомбинантного белка oprf-eta pseudomonas aeruginosa -  патент 2529359 (27.09.2014)
модифицированная дрожжевая двугибридная система для эффективного исследования взаимодействия между белками и их доменами. -  патент 2529356 (27.09.2014)
нуклеиноваяя кислота, обладающая активностью гена фосфатазы фосфатидной кислоты (варианты), белок, рекомбинантный вектор, трансформант и способ получения композиции жирной кислоты -  патент 2528875 (20.09.2014)
способ скрининга с использованием фактора, являющегося мишенью для талидомида -  патент 2528380 (20.09.2014)
слитый белок тиоредоксина и домена 4 инфестина, способ его получения, экспрессионная плазмидная днк, кодирующая слитый белок, и бактерия рода escherichia coli, трансформированная такой плазмидной днк -  патент 2528251 (10.09.2014)
полинуклеотид, кодирующий гомолог ацил-соа-синтетазы, и его применение -  патент 2528248 (10.09.2014)
тест-система для скрининга ингибиторов протеинкиназы gsk3 ; человека -  патент 2528059 (10.09.2014)
способ и набор для детекции микроорганизмов -  патент 2527897 (10.09.2014)
способ получения наноматериала на основе рекомбинантных жгутиков археи halobacterium salinarum -  патент 2526514 (20.08.2014)
рекомбинантная псевдоаденовирусная частица на основе генома аденовируса человека 5 серотипа, продуцирующая гемагглютинин вируса гриппа штамма a/brisbane/59/2007(h1n1) и способ ее использования -  патент 2523599 (20.07.2014)
