способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e. coli

Классы МПК:C12P21/00 Получение пептидов или протеинов
C07K14/175 Bunyaviridae, например вирус калифорнийского энцефалита, вирус лихорадки Rift valley, вирус Hantaan
C07K19/00 Гибридные пептиды
A61K39/12 вирусные антигены
C12N15/70 векторы или системы экспрессий, специально приспособленные для Ecoli
Автор(ы):, , , , , , , ,
Патентообладатель(и):Учреждение Российской академии медицинских наук "Институт полиомиелита и вирусных энцефалитов им. М.П. Чумакова РАМН" (RU)
Приоритеты:
подача заявки:
2011-12-26
публикация патента:

Изобретение относится к области биотехнологии, а именно к способу получения рекомбинантного антигена G2 хантавируса Добрава в клетках Е.coli. Способ характеризуется тем, что ДНК конструкции рНК6, указанной на фиг.1, кодирующая слитой белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с последовательностью аминокислот SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEW KDPDGMLKDHLNILVTKDIDFDT, а С-концевое - легкая цепь двуцепочечного белкового ингибитора типа Кунитца из клубней картофеля (PKPI-BI), вводят в клетки Е.coli. Культивируют трансформированные данной конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата центрифугированием. Продукт экспрессии в форме телец включения солюбилизируют с помощью денатуранта. Проводят хроматографию в денатурирующих условиях. Используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом. Предложенное изобретение позволяет получать рекомбинантный антиген G2 хантавируса Добрава в клетках Е.coli с увеличенным выходом. 6 ил., 1 пр. способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938

Рисунки к патенту РФ 2495938

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938

Область техники, к которой относится изобретение: Изобретение относится к области биотехнологии, в частности, к получению вакцины для профилактики вирусных инфекций, а именно инфекции геморрагической лихорадки с почечным синдромом.

Уровень техники: геморрагическая лихорадка с почечным синдромом (ГЛПС) - вирусный нетрансмиссивный зооноз, занимает в России ведущее место по числу заболевших среди природно-очаговых инфекций.

Наиболее эффективным методом борьбы с ГЛПС является специфическая профилактика, то есть вакцинация населения эндемичных регионов [1]. Инактивированная вакцина Hantavax [2] была разработана для применения в республике Корея, где доминируют виды ханавирусов Ханаан и Сеул. В настоящее время вакцина под маркой Hantavax производится промышленно и коммерчески доступна. Она разрешена для клинического применения в республике Корея.

Наряду с Hantavax в Китае и в Южной Корее разработаны, лицензированы и активно используются для профилактики ГЛПС другие варианты убитых вакцин против ГЛПС:

1) В Китае производится инактивированная формалином вакцина на основе вируса Сеул, выращенного на первичной культуре клеток почек сирийского хомячка; для инактивации вируса при производстве этой вакцины используется способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 -пропиолактон.

2) Также в Китае производится вакцина на основе вируса Хантаан, выращенного на первичной культуре клеток почек монгольской песчанки, инактивированная формалином.

3) Очищенная вакцина на основе вируса Хантаан, полученного из мозга экспериментально зараженных крыс-сосунков [3].

4) В настоящее время в Китае также разработана и проходит клинические испытания бивалентная вакцина на основе вирусов Хантаан и Сеул, полученных на перевиваемых культурах клеток Vero-Е6 (инактивация способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 -пропиолактоном). По мнению разработчиков, данный препарат должен заменить используемые инактивированные вакцины, поскольку последние в силу низкой степени очистки вызывают серьезные побочные эффекты, не обеспечивая при этом максимального уровня синтеза нейтрализующих антител.

Тем не менее, ни одна из этих вакцин не может применяться в европейских регионах России, так как не обеспечивает защиты от вирусов Пуумала и Добрава - возбудителей ГЛПС в этих регионах [4-10].

Для изготовления и контроля вакцины против вирусов Пуумала и Добрава необходимо решить проблему разработки эффективных серологических методов на основе белков внешней оболочки - энвелопа хантавирусов. Однако до настоящего времени задача получения полноразмерных коммерческих препаратов белков энвелопа G1 и G2 хантавирусов не решена нигде в мире, что обусловлено их токсичностью по отношению к бактериальным клеткам.

Ранее был получен рекомбинантный антиген G2 хантавирусов НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 12 [11]. Однако выход этого белка не превышал 20 мг на литр культуры, что в совокупности с потерями во время очистки препарата не позволяет использовать данный антиген в иммунологических тестах.

Целью нашей работы является разработка способа увеличения количества накопления продукта в штамме продуцента за счет изменения структуры целевого белка.

Раскрытие изобретения: сущностью изобретения является способ повышения выхода рекомбинантного антигена G2 хантавирусов в клетках E.coli за счет оптимизации структуры антигена до трехфункционального производного пептида НТ.

На основе конструкции рЕТ-НТ-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 12 [11], кодирующей пептид НТ в изолированном состоянии, была спроектирована и получена конструкция, где этот пептид находился в составе трифункционального слитого белка. При этом N-концевое положение занимал зеленый флуоресцентный белок GFP, центральное - пептид НТ, а С-концевое - легкая цепь двуцепочечного белкового ингибитора Кунитца из клубней картофеля (PKPI-B1). При сборке конструкций вместо вектора рЕТ23 на основе промотора Т7 был использован pQE30, содержащий менее мощный промотор Т5. Это решение было продиктовано стремлением улучшить условия фолдинга продукта за счет снижения интенсивности его накопления. С той же целью на границы доменов GFP, НТ и PKPI-B1 конструируемого трифункционального слитого белка были введены искусственные гибкие пептидные линкеры, обогащенные Gly, Ser и Ala, кодируемые синтетическими олигонуклеотидами. Кроме того, при конструировании новой плазмиды ген пептида НТ был укорочен на 40 п.н. с 3'-конца, что не сказывается на иммунохимических свойствах белка, но позволяет сократить в нем число дисульфидных связей и гидрофобных участков, что способствует улучшению растворимости продукта и ослабляет его негативное влияние на жизнеспособность клеток продуцента.

Краткое описание графических изображений:

Рис.1. Плазмидная конструкция рНК6, принципиальная схема.

Рис.2. Последовательность трифункционального слитого гена, кодирующего производное пептида НТ, в составе конструкции рНК6.

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 Последовательность гена GFP подчеркнута волнистой линией;

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 Последовательность пептида НТ из состава кДНК вируса Добрава способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 легкая цепь ингибитора Кунитца из клубней картофеля способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938

способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 искусственно введенные линкерные последовательности, обеспечивающие гибкость сочленения глобулярных доменов различного происхождения, выделены курсивом.

Рис.3. Электрофоретический анализ продуктов экспрессии конструкции рНК6 в растворимой и нерастворимой фракции лизата клеток Е.coli TG1, затрансформированных: (1) Вектором pQE30, (2) Конструкцией рНК6. Белки разделены в денатурирующем 15% ПААГ и окрашены на общий белок Coomassie Blue R-250. Стрелкой указано расположение белка НК6 (расчетная масса 42 кДа).

Рис.4. Анионообменная хроматография белка НК6 на колонке Sepharose-Q в присутствии 4М мочевины. Тонкими серыми линиями обозначены концентрация NaCl в элюирующем буфере и электропроводность раствора, черной линией - оптическая плотность при способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 =280 нм. Штриховыми линиями обозначен диапазон фракций, отобранных для электрофоретического анализа, черными линями - фракции, отобранные для дальнейшей работы.

Рис.5. Электрофоретический анализ фракций белка НК6 после ионообменной хроматографии в денатурирующих условиях. Белки разделены в денатурирующем 15% ПААГ и окрашены на общий белок Coomassie Blue R-250. Положение целевого белка массой 42 кДа обозначено пунктирным овалом. Для дальнейшей работы были отобраны фракции D6-F6.

Рис.6. Изучение антигенной активности белка НК6 методом твердофазного иммуноферментного анализа. Планшеты активированы белком-антигеном НК6 и заблокированы нормальной сывороткой кролика в разведении 100 раз. Сыворотки больных ГЛПС (вирусы Добрава, Пуумала) и здоровых доноров раститровывались в серии разведении от 20 до 1280 раз с шагом 2 раза. На оси ординат указана величина А492 каждой точки за вычетом фона (контроль без добавления сыворотки человека).

Осуществление изобретения:

Методология исследования:

1) получение конструкции

2) экспрессия и анализ выхода белка

3) подготовка образцов к хроматографии

4) ионообменная хроматография.

5) проведение иммунохимических тестов.

1) Получение конструкции

Получение конструкции проводили по следующей схеме:

1. С использованием матрицы конструкции pET-Ht-способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 12 и праймеров Li4 (GGAGATCTCTAGCGGGGGCGCCGGAGGAATT) и НТ12 (GGACTAGTATCAAAGTCAAGTGCCTT) проведена ПЦР. Продукт обработан рестриктазой BglII.

2. На матрице плазмиды pQE-GFP проведена ПЦР с использованием праймеров ECFP1 (GG GGATCCATGGTGAGCAAGGGCGAGGA) и GFP10 (GGAGATCTCTTGTACAGCTCGTCCATGCC). Продукт обработан рестриктазой BglII.

3. Продукты стадий 1 и 2 объединены и подвергнуты лигированию.

4. На матрице продукта лигирования стадии 3 проведена ПЦР с праймерами ECFP1 и НТ12. Продукт ПЦР очищен выделением из геля и подвергнут расщеплению рестриктазами BamHI и SpeI.

5. Конструкция pQ-Knl, представляющая собой ген PKPI-B1 (S.tuberosum сорт Истринский, номер доступа NCBI AY692479) в составе вектора pQE30, обработана рестриктазами SpeI и BamHI.

6. Продукты реакции рестрикции со стадий 4 и 5 объединены, подвергнуты лигированию и введены в клетки Е. coli TG1 путем трансформации.

7. Полученную промежуточную конструкцию 6 на базе вектора pQE30 расщепляли рестриктазой SpeI и лигировали с синтетическим ДНК-дуплексом, полученным путем смешения заранее фосфорилированных олигонуклеотидов CTAGCGGGGGCGCCGGAGGAATT и CTAGTTCCGGCGCCCCCG с целью введения линкерной последовательности на границе областей НТ и легкой С-концевой цепи белкового ингибитора PKPI-B1. Полученная экспрессионная конструкция на базе вектора pQE30 получила обозначение рНК6 (Рис.1 и Рис.2).

2) Экспрессия и анализ выхода белка

Конструкцию рНК6 вводили в клетки штамма Е. coli TG1, отбирая ампициллин-устойчивые колонии. Полученный продуцент культивировали при 30°С в жидкой среде (0,5% дрожжевой экстракт, 1% пептон, 0,5% NaCl) с добавлением 100 мкг/мл ампициллина в колбах Эрленмейера объемом 750 мл (30 мл среды на колбу) в течение 14-18 часов. Посевной материал представлял собой смыв культуры клеток с чашек с агаризованной средой (0,5% дрожжевой экстракт, 1% пептон, 1,5% агар, 0,5% NaCl), полученных высевом первичных трансформантов. Возраст трансформантов - не более 40 часов с момента окончания трансформации, температура культивирования - 30°С. Доза засева - 5×108 клеток на колбу. Индукцию промотора в клетках продуцента не проводили.

Оценку выхода целевого продукта осуществляли с помощью электрофоретического анализа суммарных белков рекомбинантного продуцента по Лэммли. Для этого из грубого клеточного лизата каждой культуры отбирали по 100 мкл. Лизат подвергали центрифугированию при 14000 G. в течение 15 мин и разделяли растворимую и нерастворимую клеточную фракции. Белки солюбилизировали в 30 мкл буфере Лэммли и анализировали состав белков с помощью денатурирующего SDS-электрофореза в 15% ПААГ (Рис.3).

Проведенный анализ показал, что трифункциональный слитой белок на основе пептида НТ - продукт конструкции рНК6, как и свободный пептид НТ, накапливается в нерастворимой клеточной фракции, с выходом около 40 мг/л культуры.

3) Подготовка образцов к хроматографии

Грубый клеточный лизат культуры TGl(pHK6) подвергали центрифугированию при 8000 G. в течение 1 часа и разделяли растворимую и нерастворимую клеточную фракции. Объединенный осадок нерастворимой клеточной фракций трижды промывали: в 25 мл 4 М NaCl с добавлением 1% тритона, в 25 мл физиологического раствора с 1% тритоном и в 25 мл воды. Осадок суспендировали в 8 мл буфера (Tris-HCl, 10 мМ, рН=8,6), содержащего 8 М мочевину и 0,1% способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 -меркаптоэтанол. Раствор кипятили на водяной бане в течение 10 минут и центрифугировали. Полученный осветленный супернатант наносили на гельфильтрационную хроматографическую колонку с Sephadex G-25 fine со скоростью 5 мл/мин, используя жидкостную хроматографическую систему низкого давления "AKTA-Purifile" (GE Healthcare, США). Разделение проводили в буфере (Tris-HCl, 10 мМ, рН=8,6), содержащего 4 М мочевину, с целью удаления солей, избытка восстановителя и низкомолекулярных клеточных примесей. Солюбилизированный в денатурирующих условиях белок подвергали очистке с помощью анионообменной хроматографии.

Выделение и очистку целевых белков из полученного супернатанта проводили с использованием жидкостной хроматографической системы "AKTA-Purifile" (GE Healthcare, США).

4) Ионообменная хроматография

Основной целью анионнобменной хроматографии белков - производных пептида НТ в денатурирующих условиях, являлось удаление примесей нуклеиновых кислот, формирующих коллоид с участием белков и препятствующих эффективному применению гель-фильтрации и других методов хроматографии. При этом удаление из препарата примесей клеточных белков Е.coli рассматривалась лишь как побочная задача.

Полученный после гель-фильтрации раствор денатурированного белка НК6 в объеме 15 мл наносили на анионообменную колонку Sepharose-Q (XL) (GE Healthcare, США, высота 24 см, объем 48 мл), уравновешенную буфером А. Элюцию проводили линейным градиентом NaCl от 0 до 0,5 М в хроматографическом буфере В (Tris-HCl, 10 мМ, рН=8,6, 4 М мочевина, 1 М NaCl) со скоростью 8 мл/мин (Рис.4).

Собранные 20 фракций объемом 10 мл каждая анализировали с помощью денатурирующего SDS-электрофореза в 15% ПААГ. Для электрофореза отбиралось по 50-100 мкл от каждой фракции. Белки подвергали осаждению в 1 мл смеси (500 мкл 100% ацетона, 100 мкл 70% ТХУ на 1 мл). Полученные осадки солюбилизировали в денатурирующих условиях в 15 мкл буфера Лэммли (с добавлением мочевины) (Рис.5).

Материал фракций белка НК6, полученных в результате анионообменной хроматографии в денатурирующих условиях, оказался иммунохимически чистым и электрофоретически гомогенным, что позволило непосредственно использовать его для проведения ренатурации и иммунохимических тестов (Рис.6).

5) Проведение иммунохимических тестов

В качестве формата проведения анализа был выбран вариант тИФА с непосредственной сорбцией рекомбинантного белка-антигена НК6 на поверхность иммунологического планшета. В эксперименте использовались хроматографически очищенный белок НК6 в денатурированной форме. В процессе сорбции белковый препарат, хранящийся в виде концентрированных растворов в присутствии 4 М мочевины, разводили в 20-50 раз карбонат-бикарбонатным буфером (КГБ), доводя концентрацию общего белка в растворе до 10 мкг/мл. Полученный раствор вносили в иммунологические планшеты на 1 сутки, после чего проводили блокирование неспецифического связывания на подложке с помощью 1% БСА в буфере КГБ. Необходимым этапом проведения анализа оказалось блокирование связывания нормальных антител, присутствующих в сыворотке крови здоровых доноров, за счет конкуренции. С этой целью планшеты, подвергшиеся блокированию 1% БСА, дополнительно обрабатывали, внося в каждую лунку нормальную кроличью сыворотку, разбавленную буфером PBS в соотношении 1:100.

На следующей стадии проведения анализа проводилось серийное титрование анализируемой сыворотки больных ГЛПС (или здоровых доноров в группе сравнения). При этом с целью исследования специфичности реакции в выборки сравнения включали а) больных ГЛПС, инфицированных вирусом Добрава, b) больных ГЛПС, инфицированных вирусом Пуумала, с) здоровых доноров. В качестве контрольного образца использовали лунки планшета, в которые вместо разведенной сыворотки человека вносили буфер PBS («конъюгатный контроль»).

В заключение все лунки планшета обрабатывали антивидовым конюгатом против IgG человека, меченным пероксидазой, и субстратом ТМВ в присутствии пероксида водорода. Сигнал мерили на планшетном сканере-спектрофотометре при способ получения рекомбинантного антигена g2 хантавируса добрава   в клетках e. coli, патент № 2495938 =492 нм. Результаты определений представлены на Рис.6.

Результаты показывают высокую реакционную способность антител положительных сывороток в отношении антигена НК6. При этом сигналы положительных сывороток больных в 2-2,5 раза превышают сигнал сывороток здоровых доноров в том же разведении, что позволяет достоверно диагносцировать наличие в крови людей специфических антител против вирусов Добрава и Пуумала.

Список использованных источников

1. Maes P., Clement J., Van Ranst M. Recent approaches in hantavirus vaccine development. - Expert Rev Vaccines. - 2009 - V.8, № 1, P.67-76.

2. Cho H.W., Howard C.R., Lee H.W. Review of an inactivated vaccine against hantaviruses. - Intervirology. - 2002 - V.45, № 4-6, P.328-333.

3. Song G. Epidemiological progresses of hemorrhagic fever with renal syndrome in China. - Chin Med J (Engi). - 1999 - V.112, № 5, P.472-477.

4. Oya A. Japanese encephalitis vaccine. - Acta Paediatr Jpn. - 1988 - V.30, № 2, Р.175-184.

5. Choi Y. Ahn C.J., Seong K.M., Jung M.Y., Ahn B.Y. Inactivated Hantaan virus vaccine derived from suspension culture of Vero cells. - Vaccine. - 2003 - V.21, № 17-18, P.1867-1873.

6. Lee H.W., Chu Y.K., Woo Y.D. Immune responses after two or three doses of Hantavax vaccination against Hantaan virus // Proc. fifth international conference on hemorrhagic fever with renal syndrome, hantavirus pulmonary syndrome and hantaviruses. Lion, Franch - 2001. - P.234-242.

7. Ruan Y., Xu X., Liu W., Deng X, Weng S, Zhou W, Wang Q, Chen L, Fang L, Xu Z, Yan Q, Liu W, Dong G, Gu H, Yu Y, Xu Z. A study on immunogenicity and safety of bivalent inactivated vaccine against hemorrhagic fever with renal syndrome. - Zhonghua Yu Fang Yi Xue Za Zhi. - 1999 - V.33, № 6, P.340-342.

8. Hooper J.W., Kamrud K.I., Eigh F., Custer D., Schmaljohn C.S. DNA vaccination with hantavirus M segment elicits neutralizing antibodies and protects against seoul virus infection. - Virology. - 1999 - V.255, № 2, P.269-278.

9. Kallio-Kokko H., Leveelahti R., Brummer-Korvenkontio M., Lundkvist A., Vaheri A., Vapalahti O. Human immune response to Puumala virus glycoproteins and nucleocapsid protein expressed in mammalian cells. - J Med Virol. - 2001 - V.65, № 3, P.605-613.

10. Huang H., Li X., Zehua Z. Genetic immunization with Hantavirus vaccine combining expression of G2 glycoprotein and fused interleukin-2. - Genetic Vaccines and Therapy. - 2008 - V.6. - P.15-21.

11. А.Б.Шевелев, М.С.Барботько, М.В.Баловнева, Е.Ю.Эпова, О.А.Леонович, Т.К.Дзагурова, Е.А.Ткаченко. Способ получения рекомбинантного антигена G2 хантавирусов в клетках Е.coli. Заявка на патент. Вход. № 060029. Peг. № 2010141819. Дата поступления 13.10.2010.

ФОРМУЛА ИЗОБРЕТЕНИЯ

Способ получения рекомбинантного антигена G2 хантавируса Добрава в клетках Е.coli, характеризующийся тем, что ДНК конструкции рНК6, указанной на фиг.1, кодирующая слитой белок из трех частей, где N - концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с последовательностью аминокислот SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEWKD PDGMLKDHLNILVTKDIDFDT, а С-концевое - легкая цепь двуцепочечного белкового ингибитора типа Кунитца из клубней картофеля (PKPI-BI), вводят в клетки Е.coli, культивируют трансформированные данной конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата центрифугированием, продукт экспрессии в форме телец включения солюбилизируют с помощью денатуранта, проводят хроматографию в денатурирующих условиях и используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом.


Скачать патент РФ Официальная публикация
патента РФ № 2495938

patent-2495938.pdf
Патентный поиск по классам МПК-8:

Класс C12P21/00 Получение пептидов или протеинов

Патенты РФ в классе C12P21/00:
рекомбинантная плазмидная днк ppa-oprf-eta, кодирующая синтез рекомбинантного белка oprf-eta pseudomonas aeruginosa, штамм escherichia coli pa-oprf-eta - продуцент рекомбинантного белка oprf-eta pseudomonas aeruginosa и способ получения рекомбинантного белка oprf-eta pseudomonas aeruginosa -  патент 2529359 (27.09.2014)
модифицированная дрожжевая двугибридная система для эффективного исследования взаимодействия между белками и их доменами. -  патент 2529356 (27.09.2014)
лейколектины и их применение -  патент 2528860 (20.09.2014)
модифицированный фактор виллебранда с удлиненным полупериодом существования in vivo, его применения и способы получения -  патент 2528855 (20.09.2014)
способ получения пептидов, специфично распознающих определенные типы клеток и предназначенных для терапевтических целей -  патент 2528739 (20.09.2014)
слитый белок тиоредоксина и домена 4 инфестина, способ его получения, экспрессионная плазмидная днк, кодирующая слитый белок, и бактерия рода escherichia coli, трансформированная такой плазмидной днк -  патент 2528251 (10.09.2014)
способ получения цитохрома с -  патент 2528061 (10.09.2014)
рсв-специфичные связывающие молекулы и средства для их получения -  патент 2527067 (27.08.2014)
способы, относящиеся к модифицированным гликанам -  патент 2526250 (20.08.2014)
l-фукоза 1 6 специфичный лектин -  патент 2524425 (27.07.2014)

Класс C07K14/175 Bunyaviridae, например вирус калифорнийского энцефалита, вирус лихорадки Rift valley, вирус Hantaan

Класс C07K19/00 Гибридные пептиды

Патенты РФ в классе C07K19/00:
модифицированный фактор виллебранда с удлиненным полупериодом существования in vivo, его применения и способы получения -  патент 2528855 (20.09.2014)
слитый белок тиоредоксина и домена 4 инфестина, способ его получения, экспрессионная плазмидная днк, кодирующая слитый белок, и бактерия рода escherichia coli, трансформированная такой плазмидной днк -  патент 2528251 (10.09.2014)
проникающие в клетку пептиды и полипептиды для клеток микроорганизмов -  патент 2526511 (20.08.2014)
терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами -  патент 2524129 (27.07.2014)
искусственный ген mel-tci-a0201, кодирующий полиэпитопный белок-иммуноген mel-tci-a0201, рекомбинантная плазмидная днк pmel-tci-a0201, обеспечивающая экспрессию искусственного гена mel-tci-a0201 и искусственный белок-иммуноген mel-tci-a0201, содержащий множественные ctl- и th-эпитопы антигенов меланомы -  патент 2522830 (20.07.2014)
антитело двойной направленности в новой форме и его применение -  патент 2520824 (27.06.2014)
мультизимы и их использование в получении полиненасыщенных жирных кислот -  патент 2517608 (27.05.2014)
гибридный белок на основе рекомбинантного эритропоэтина человека, обладающий пролонгированным действием (варианты), и способ его получения -  патент 2515914 (20.05.2014)
гибридный белок, обладающий пролонгированным действием, на основе рекомбинантного интерферона альфа-2 человека (варианты), способ его получения и штамм saccharomyces cerevisiae для осуществления этого способа (варианты) -  патент 2515913 (20.05.2014)
рекомбинантные химерные полипептиды, несущие эпитопы различных иммунодоминантных белков спирохет комплекса borrelia burgdorferi sensu lato, и способ серодиагностики иксодового клещевого боррелиоза -  патент 2514230 (27.04.2014)

Класс A61K39/12 вирусные антигены

Патенты РФ в классе A61K39/12:
штамм "г 244/11" вируса блютанга 14 серотипа для вирусологических исследований, изготовления вакцинных и диагностических препаратов -  патент 2528057 (10.09.2014)
флавивирус с двухкомпонентным геномом и его использование -  патент 2527891 (10.09.2014)
поликатионное соединение "тривирон (triviron)" и способ его получения -  патент 2527256 (27.08.2014)
вирус диареи крупного рогатого скота с модифицированным белком erns -  патент 2524426 (27.07.2014)
вакцина против гриппа и способ ее получения -  патент 2523614 (20.07.2014)
лечение prdc у молодых свиней -  патент 2522849 (20.07.2014)
предупреждение и лечение субклинической формы болезней, вызываемых цирковирусом свиней (pcvd) -  патент 2520759 (27.06.2014)
химерный цирковирус pcv2gen-1rep свиней и его применение -  патент 2515901 (20.05.2014)
вакцина ассоциированная против сальмонеллеза, эшерихиоза и вирусной геморрагической болезни кроликов -  патент 2510839 (10.04.2014)
вакцинная композиция, пригодная при инфекциях hpv и вирусом гепатита в, и способ ее получения -  патент 2509570 (20.03.2014)

Класс C12N15/70 векторы или системы экспрессий, специально приспособленные для Ecoli

Патенты РФ в классе C12N15/70:
рекомбинантная днк, кодирующая гранулоцитарный колониестимулирующий фактор человека (g-csf) и рекомбинантная плазмида рas017, обеспечивающая синтез g-csf в клетках escherichia coli -  патент 2529363 (27.09.2014)
рекомбинантная днк, кодирующая гибридный белок эпидермального фактора роста человека слитого последовательностью глутатион-s-трансферазы (gst-hegf) и рекомбинантная плазмида pas007, обеспечивающая синтез gst-hegf в клетках escherichia coli -  патент 2521515 (27.06.2014)
рекомбинантная плазмидная днк pg1-rm7, обеспечивающая синтез гибридного белка g1-rm7, и гибридный белок, связывающий фактор некроза опухолей и обладающий биолюминесцентной активностью -  патент 2513686 (20.04.2014)
рекомбинантная плазмидная днк pqe-p35d, обеспечивающая синтез рекомбинантного белка p35d вируса оспы коров, штамм бактерий escherichia coli - продуцент рекомбинантного белка p35d вируса оспы коров и рекомбинантный белок p35d вируса оспы коров, используемый для создания тест-систем и конструирования субъединичных вакцин против ортопоксвирусных инфекций -  патент 2511037 (10.04.2014)
способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli -  патент 2509805 (20.03.2014)
рекомбинантный полипептид а2, селективно связывающий hsa, рекомбинантная днк pa2, кодирующая hsa-связывающую часть полипептида a2, его продуцент - рекомбинантный штамм escherichia coli m15-a2, содержащий рекомбинантную плазмидную днк pqe 32-pa2, обеспечивающую получение полипептида a2 и применение полипептида а2 для диагностики микроальбуминурии и выделения hsa из сыворотки крови -  патент 2506271 (10.02.2014)
система экспрессии компонентов ортогональной трансляции в эубактериальной клетке-хозяине -  патент 2467069 (20.11.2012)
штамм клеток e.coli bl21(de3)plyss, клон ptt9/asfvp30, содержащий рекомбинантную плазмиду со встройкой участка гена ср204l вируса африканской чумы свиней, кодирующего конформационный эпитоп белка p30, для изготовления диагностических препаратов -  патент 2463343 (10.10.2012)
рекомбинантная плазмидная днк pтв323, кодирующая гибридный полипептид gst-дельтамрт64 со свойствами видоспецифичного микобактериального антигена мрт64 (мрв64), рекомбинантный штамм бактерий escherichia coli - продуцент гибридного полипептида gst-дельтамрт64 и рекомбинантный полипептид gst-дельтамрт64 -  патент 2458130 (10.08.2012)
состав полиэпитопного белка для индукции иммунного ответа против вируса ящура -  патент 2453557 (20.06.2012)


Наверх