Поиск патентов
ПАТЕНТНЫЙ ПОИСК В РФ

способ ферментативного удаления биопленки, композиция и набор

Классы МПК:C11D3/386 препараты, содержащие ферменты
C12N9/00 Ферменты, например лигазы (6); проферменты; композиции их; способы получения, активирования, ингибирования, разделения или очистки ферментов
Автор(ы):, ,
Патентообладатель(и):ДАНИСКО ЮЖс ИНК. (US)
Приоритеты:
подача заявки:
2008-12-16
публикация патента:

Изобретение относится к областям биохимии и микробиологии. Предложен способ удаления биопленки с поверхности на основе обработки пергидролазой и смесью ферментов, а также соответствующие набор и композиция. Изобретение может быть использовано для контроля биопленок в областях промышленности, стоматологии и охраны здоровья. 3 н. и 16 з.п. ф-лы, 10 табл, 8 пр.

Родственные заявки

Настоящая заявка испрашивает приоритет к заявке на патент США № 61/015504, поданной 20 декабря 2007, которая включена в настоящее описание в полном объеме посредством ссылки.

Область техники, к которой относится изобретение

Настоящее изобретение относится к композициям фермента и способам удаления биопленок с поверхностей. В частности, способы удаления биопленки включают применение фермента пергидролазы совместно с другими ферментами к биопленке на поверхности.

Уровень техники

Биопленки состоят из присоединенного сообщества микроорганизмов, помещенного в вязкую экзополимерную матрицу, которое часто продолжает существовать, несмотря на контролируемые попытки с традиционными подходами, разработанными для уничтожения свободно плавающих микроорганизмов. Устойчивость биопленок к антибиотикам, антисептикам и окисляющим биоцидам было хорошо задокументировано.

Ферментативные способы предотвращения образования и/или сокращения биопленок были описаны, например, в PCT заявках на патент № WO 06/031554, WO 01/98214, WO 98/26807, WO 04/041988, WO 99/14312 и WO 01/53010. Однако существует потребность в улучшенных способах и композициях для контроля биопленок в областях применения промышленности, стоматологии и охраны здоровья.

Сущность изобретения

Изобретение обеспечивает способы, композиции и наборы для удаления биопленки. В одном аспекте изобретение обеспечивает способ удаления биопленки с поверхности, указанный способ, включающий применение фермента пергидролазы и смеси ферментов для удаления к указанной биопленке в течение времени, достаточного для сокращения указанной биопленки, по меньшей мере, на 25%, в котором указанная смесь ферментов выбрана из протеазы, глюканазы и эстеразы; протеазы, глюканазы, эстеразы и маннаназы; протеазы, глюканазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, глюканазы и маннаназы; двух протеаз, целлюлазы, глюканаз, фосфолипазы и маннаназы; протеазы, глюканазы и маннаназы; протеазы, целлюлазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, целлюлазы, фосфолипазы и глюканазы; трех протеаз, целлюлазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и эстеразы; протеазы, целлюлазы, глюканазы, фосфолипазы и эстеразы; по меньшей мере двух амилаз и глюканазы; по меньшей мере трех амилаз; и по меньшей мере двух амилаз, глюканазы и протеазы. В некоторых вариантах осуществления биопленка содержит Pseudomonas aeruginosa, Listeria monocytogenes или Staphylococcus aureus. В некоторых вариантах осуществления фермент пергидролаза включает аминокислотную последовательность, описанную в SEQ ID NO:1, или разновидность, или ее гомолог. В одном варианте осуществления фермент пергидролаза представляет собой разновидность S54V SEQ ID NO:1.

В одном варианте осуществления смесь ферментов для удаления состоит из трех протеаз, глюканазы, фосфолипазы и маннаназы. В одном варианте осуществления смесь ферментов для удаления состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC 265 и LYSOMAX.

В одном варианте осуществления фермент пергидролазу и смесь ферментов для удаления применяют к биопленке одновременно. В другом варианте осуществления смесь фермента пергидролазы и смесь ферментов для удаления применяют к биопленке последовательно. В одном варианте осуществления фермент пергидролазу применяют до использования смеси ферментов для удаления. В одном варианте осуществления фермент пергидролаза и смесь ферментов для удаления действуют синергетически для удаления биопленки с поверхности.

В другом аспекте изобретение обеспечивает композицию для удаления биопленки с поверхности, указанная композиция, включающая фермент пергидролазу и смесь ферментов для удаления, в которой указанная смесь ферментов для удаления выбрана из протеазы, глюканазы и эстеразы; протеазы, глюканазы, эстеразы и маннаназы; протеазы, глюканазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, глюканазы и маннаназы; двух протеаз, целлюлазы, глюканаз, фосфолипазы и маннаназы; протеазы, глюканазы и маннаназы; протеазы, целлюлазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, целлюлазы, фосфолипазы и глюканазы; трех протеаз, целлюлазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и эстеразы; протеазы, целлюлазы, глюканазы, фосфолипазы и эстеразы; по меньшей мере двух амилаз и глюканазы; по меньшей мере трех амилаз; и по меньшей мере двух амилаз, глюканазы и протеазы.

В одном варианте осуществления смесь ферментов для удаления состоит из трех протеаз, глюканазы, фосфолипазы и маннаназы. В одном варианте осуществления смесь ферментов для удаления состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC 265 и LYSOMAX.

В некоторых вариантах осуществления фермент пергидролаза содержит аминокислотную последовательность, описанную в SEQ ID NO:1, или разновидность, или ее гомолог. В одном варианте осуществления фермент пергидролаза представляет собой разновидность S54V SEQ ID NO:1.

В другом аспекте изобретение обеспечивает набор для удаления биопленки с поверхности, указанный набор, включающий фермент пергидролазу и смесь ферментов для удаления, в котором указанная смесь ферментов выбрана из группы, состоящей из протеазы, глюканазы и эстеразы; протеазы, глюканазы, эстеразы и маннаназы; протеазы, глюканазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, глюканазы и маннаназы; двух протеаз, целлюлазы, глюканаз, фосфолипазы и маннаназы; протеазы, глюканазы и маннаназы; протеазы, целлюлазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, целлюлазы, фосфолипазы и глюканазы; трех протеаз, целлюлазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и эстеразы; протеазы, целлюлазы, глюканазы, фосфолипазы и эстеразы; по меньшей мере двух амилаз и глюканазы; по меньшей мере трех амилаз; и по меньшей мере двух амилаз, глюканазы и протеазы и необязательно, инструкции по применению для способа удаления биопленки, как описано в настоящей заявке. В одном варианте осуществления фермент пергидролаза и смесь ферментов для удаления находятся в отдельных емкостях. В одном варианте осуществления фермент пергидролаза и смесь ферментов для удаления находятся в одной емкости.

В одном варианте осуществления смесь ферментов для удаления состоит из трех протеаз, глюканазы, фосфолипазы и маннаназы. В одном варианте осуществления смесь ферментов для удаления состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC 265 и LYSOMAX.

В некоторых вариантах осуществления фермент пергидролаза включает аминокислотную последовательность, описанную в SEQ ID NO:1, или разновидность, или ее гомолог. В одном варианте осуществления фермент пергидролаза представляет собой разновидность S54V SEQ ID NO:1.

Подробное описание

Изобретение обеспечивает способы, композиции и наборы для контроля, то есть удаления или сокращения биопленки на поверхности или предотвращения образования или роста биопленки на поверхности. Композиции, содержащие ферменты, и способы изобретения применяют для контроля биопленок, например, в управлении промышленным водоснабжением, таком как градирни, питьевая вода, сточные воды, стоматологической гигиене, медицинских имплантах и устройствах, системах гемодиализа, регенерации масла, биоремедиации колодцев, целлюлозно-бумажной обработке, корпусах кораблей, оборудовании для обработки продуктов и водных системах доставки, например, трубы, шланги труб и подобные.

Если в настоящем описании не определено иначе, все технические и научные термины, используемые в настоящем описании, имеют то же самое значение, как обычно понимает специалист в данной области техники. Singleton, et al., Dictionary of Microbiology and Molecular Biology, second ed., John Wiley and Sons, New York (1994) и Hale & Markham, The Harper Collins Dictionary of Biology, Harper Perennial, NY (1991) обеспечивают специалиста в данной области техники общим словарем многих терминов, используемых в этом изобретении. Любые способы и материалы, подобные или эквивалентные описанным в настоящей заявке, могут использовать на практике или при испытании настоящего изобретения.

Числовые диапазоны, представленные в настоящем описании, включают числа, определяющие диапазон.

Если не обозначено иначе, нуклеиновые кислоты написаны слева направо в направлении 5'-3'; аминокислотные последовательности написаны слева направо в направлении от амино к карбокси, соответственно.

Определения

«Биопленка» относится к сообществу микроорганизмов, заключенному во внеклеточную матрицу полимера, присоединенную к поверхности. Биопленка дополнительно включает воду и может включать другие захваченные частицы. Биопленка может включать один или более микроорганизмов, включая грам-положительные или грам-отрицательные бактерии (аэробные или анаэробные), морские водоросли, простейшие животные организмы и/или дрожжи или мицелиальные грибы. В некоторых вариантах осуществления биопленка включает живые клетки бактерий родов Staphylococcus, Streptomyces, Pseudomonas, Listeria, Streptococcus и Escherichia.

«Поверхность» относится к любой структуре, имеющей достаточную массу для присоединения биопленки. Твердые поверхности включают, но не ограничиваются ими, металл, стекло, керамический материал, дерево, минерал (например, горная порода, камень, мрамор, гранит), агрегированные материалы, такие как бетон, пластмасса, композитный материал, эбонитовый материал и гипс. Твердый материал может быть покрыт эмалью и/или краской. Твердые поверхности обнаружены, например, в оборудовании и резервуарах для обработки и хранения воды, оборудовании и оснащении молочной и пищевой промышленности, оборудовании и оснащении медицины, например, хирургические инструменты, постоянные и временные импланты и промышленном фармацевтическом оборудовании и на заводах. Мягкие поверхности включают, но не ограничиваются ими, волосы и текстильные изделия. Пористые поверхности могут быть биологическими поверхностями, включая, но не ограничиваясь ими, кожу, кератин и внутренние органы. Пористые поверхности могут также быть найдены в определенном керамическом материале так же как в мембранах, которые используют для фильтрации. Другие поверхности включают, но не ограничиваются ими, корпуса кораблей и плавательные бассейны.

«Дозировка фермента» относится к количеству смеси ферментов, количеству единичного фермента в смеси ферментов или количеству используемого отдельно единичного фермента, применяемому для обработки биопленки. Факторы, влияющие на дозировку фермента, включают, но не ограничиваются ими, тип фермента, поверхность, которую будут обрабатывать, и намеченный результат. В некоторых вариантах осуществления дозировка фермента представляет собой количество смеси ферментов, необходимое для сокращения биопленки по меньшей мере на приблизительно 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 98 или 99%. Обычно содержание фермента в смеси ферментов представляет собой в общем приблизительно 1% или менее, 2% или менее, 3% или менее или 5% или менее (вес./вес.).

«Обработка» или «контроль», или «удаление» биопленки относится к сокращению или удалению биопленки с поверхности, включая уничтожение и/или ингибирование роста микробов в биопленке и/или профилактическое предотвращение образования или роста биопленки на поверхности.

«Смесь ферментов» относится по меньшей мере к двум ферментам. Описанные в настоящей заявке ферменты, используемые в смесях ферментов, могут быть получены из растительных или животных источников, бактерий, грибов или дрожжей и могут быть дикого типа или различными ферментами.

«Кислотная среда», «нейтральная среда» и «основная среда» хорошо известны специалисту в данной области техники. Как правило, «кислотная среда» относится к pH от около 4 до приблизительно 6. «Нейтральная среда» относится к pH от приблизительно 6 до приблизительно 8. «Основная среда» относится к pH от приблизительно 8 до приблизительно 10.

«Пергидролаза» относится к ферменту, который способен к катализу реакции пергидролиза, которая приводит к получению достаточно большого количества перкислоты, подходящей для использования, такого как очистка, отбеливание, дезинфекция или стерилизация объекта (например, обработка биопленки, как описано в настоящей заявке). Обычно фермент пергидролаза, используемый в способах, описанных в настоящей заявке, показывает высокое отношение реакций пергидролиза к гидролизу. В некоторых вариантах осуществления пергидролаза включает, состоит из или состоит по существу из пергидролазы Mycobacterium smegmatis аминокислотной последовательности, описанной в SEQ ID NO:1, или разновидности, или ее гомолога. В некоторых вариантах осуществления фермент пергидролаза включает активность ацилтрансферазы и катализирует водную реакцию переноса ацила.

«Перкислота» представляет собой органическую кислоту формулы RC(=O)OOH.

«Пергидролиз» или «пергидролизировать» относится к ферментативной реакции, в результате которой получают перкислоту. В некоторых вариантах осуществления перкислоту получают пергидролизом основания сложного эфира формулы R1C(=O)OR 2, в которой R1 и R2 представляют собой одинаковые или различные органические части, в присутствии пероксида водорода (H2O2).

Фраза «источник пероксида водорода» включает пероксид водорода так же как компоненты системы, которая может самопроизвольно или ферментативно производить пероксид водорода в качестве продукта реакции.

Фраза «отношение пергидролиза к гидролизу» относится к отношению количества ферментативно полученной перкислоты к количеству ферментативно полученной кислоты с помощью фермента пергидролазы из основания сложного эфира при определенных условиях и в пределах определенного времени.

Используемый в настоящем описании термин «ацил» относится к органической кислотной группе, которая представляет собой остаток карбоновой кислоты после удаления гидроксильной группы (-ОН) (например, этаноилхлорид, CH3CO-Cl, представляет собой ацилхлорид, образованный из этановой кислоты, CH3 CO-ОН). Название индивидуальной ацильной группы обычно образуют, заменяя «-вая» кислоты на «-ил».

Используемый в настоящем описании термин «ацилирование» относится к химическому превращению, в котором ацильной группой (RCO-) группой замещают в молекуле обычно активный водород -ОН группы.

Используемый в настоящем описании термин «трансфераза» относится к ферменту, который катализирует перенос функциональной группы от одного субстрата к другому субстрату.

Используемый в настоящем описании «белок» относится к любой композиции, состоящей из аминокислот и признанной белком специалистом в данной области техники. Термины «полипептид», «олигопептид», «пептид» и «белок» используют в настоящем описании взаимозаменяемо для обозначения полимеров аминокислот любой длины. Полимер может быть линейным или разветвленным, он может содержать модифицированные аминокислоты и он может быть прерван не аминокислотами. Термины также охватывают аминокислотный полимер, который был модифицирован естественным образом или при помощи вмешательства; например, образование дисульфидной связи, гликозилирование, липидизация, ацетилирование, фосфорилирование или любое другое превращение или модификация, такое как конъюгация с меченым компонентом. Также в пределах определения находятся, например, полипептиды, содержащие один или более аналогов аминокислоты (включая, например, неприродные аминокислоты и т.д.), также как другие модификации, известные специалисту в данной области техники.

Используемый в настоящем описании «мультимер» относится к двум или более белкам или пептидам, которые ковалентно или нековалентно связаны и существуют в качестве комплекса в растворе. «Димер» представляет собой мультимер, который содержит два белка или пептида; «тример» содержит три белка или пептида, и т.д. Используемый в настоящем описании «октамер» относится к мультимеру из восьми белков или пептидов. Белки или пептиды мультимера могут быть одинаковыми или различными.

Используемое в настоящем описании «эффективное количество фермента» относится к количеству фермента, необходимому для достижения ферментативной активности, требуемой в определенной заявке (например, удаление биопленки).

Полагают, что используемые в настоящем описании функционально и/или структурно подобные белки представляют собой «родственные белки». В некоторых вариантах осуществления родственные белки получают из различных родов и/или видов, включая различия между классами или организмами (например, бактериальный белок и грибковый белок). В некоторых вариантах осуществления родственные белки получают из одинаковых видов. Кроме того, термин «родственные белки» охватывает гомологи с третичной структурой и гомологи с первичной последовательностью. Термин также охватывает белки, которые являются иммунологически перекрестно-активными. В некоторых вариантах осуществления ферменты, родственные пергидролазе, показывают высокие отношения пергидролиза к гидролизу.

Используемый в настоящем описании термин «производное» относится к белку, который получают из исходного белка добавлением одной или более аминокислот или к любому из двух, или к обоим вместе C- и N-концу(ам), замещением одной или более аминокислот на одном или множестве различных участков в аминокислотной последовательности и/или удалением одной или более аминокислот на любом из двух или обоих вместе C- и N-конце(ах) и/или на одном или более участках аминокислотной последовательности, и/или вставкой одной или более аминокислот на одном или более участках аминокислотной последовательности. Получение производного белка часто достигают модифицированием последовательности ДНК, которая кодирует нативный белок, превращением модифицированной последовательности ДНК в подходящего хозяина и экспрессией модифицированной последовательности ДНК для получения производного белка.

Родственные (и производные) белки охватывают «вариантные» белки. Вариантные белки отличаются от исходного белка и/или друг от друга небольшим количеством остатков аминокислот. В некоторых вариантах осуществления число различных остатков аминокислот представляет собой любое из приблизительно 1, 2, 3, 4, 5, 10, 20, 25, 30, 35, 40, 45 или 50. В некоторых вариантах осуществления варианты отличаются от приблизительно 1 до приблизительно 10 аминокислот.

В некоторых вариантах осуществления родственные белки, такие как вариантные белки, включают любую из по меньшей мере приблизительно 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или 99,5% идентичность аминокислотной последовательности.

Используемый в настоящем описании термин «аналогичная последовательность» относится к последовательности полипептида в пределах белка, которая обеспечивает подобную функцию, третичную структуру и/или сохраненные остатки относительно эталонного белка. Например, в областях антигенной детерминанты, которые содержат структуру альфа-спирали или бета-листа, замещение аминокислот(ы) в аналогичной последовательности поддерживает одинаковый структурный элемент. В некоторых вариантах осуществления обеспечивают аналогичные последовательности, которые приводят к вариантным ферментам, показывающим подобную или улучшенную функцию относительно исходного белка, из которого получен вариант.

Используемый в настоящем описании «гомологичный белок» относится к белку (например, фермент пергидролаза), который имеет подобную функцию (например, ферментативная активность) и/или структуру как эталонный белок (например, фермент пергидролаза из различных источников). Гомологи могут быть эволюционно связанными или несвязанными видами. В некоторых вариантах осуществления гомолог имеет четвертичную, третичную и/или первичную структуру, подобную структуре эталонного белка, таким образом потенциально учитывая замещение сегмента или фрагмента в эталонном белке на аналогичный сегмент или фрагмент гомолога с уменьшенным разрушением структуры и/или функции эталонного белка по сравнению с замещением сегмента или фрагмента последовательностью негомологичного белка.

Используемый в настоящем описании «соответствующий» относится к аминокислотному остатку в одном белке или пептиде, который представляет собой аналогичный, гомологичный или эквивалентный перечисленному остатку аминокислоты в другом белке или пептиде.

Используемая в настоящем описании «соответствующая область» относится к аналогичным, гомологичным или эквивалентным положениям или областям в полипептидных последовательностях двух белков или пептидов, включая два производных, или вариантные белки, или производное, или вариантный белок и исходный белок.

Используемые в настоящем описании «дикого типа», «нативные» и «природные» белки представляют собой белки, обнаруженные в природе. Термины «последовательность дикого типа» относятся к последовательности аминокислоты или нуклеиновой кислоты, которая обнаружена в природе или естественным образом. В некоторых вариантах осуществления последовательность дикого типа представляет собой отправную точку проекта белковой инженерии, например, получение вариантных белков.

Фразы «по существу подобный» и «по существу идентичный» в контексте по меньшей мере двух нуклеиновых кислот или полипептидов обычно означают, что полинуклеотид или полипептид содержит последовательность, которая имеет по меньшей мере приблизительно 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, или 99,5% идентичность последовательности по сравнению с эталонным (например, дикого типа) полинуклеотидом или полипептидом. Идентичность последовательности могут определить, применяя известные программы, такие как BLAST, ALIGN и CLUSTAL, используя стандартные параметры. (См., например, Altshul et al. (1990) J MoI. Biol. 215:403-410; Henikoff et al. (1989) Proc. Natl. Acad. Sci. 89:10915; Karin et al. (1993) Proc. Natl. Acad. Sci. 90:5873; и Higgins et al. (1988) Gene 73:237). Программное обеспечение для проведения исследования BLAST общедоступно через Национальный Центр Биотехнологической Информации. Кроме того, базы данных могут обнаружить, используя FASTA (Person et al. (1988) Proc. Natl. Acad. Sci. 85:2444-2448). В некоторых вариантах осуществления по существу идентичные полипептиды отличаются только одним или более консервативными замещениями аминокислоты. В некоторых вариантах осуществления по существу идентичные полипептиды являются иммунологически перекрестно-активными. В некоторых вариантах осуществления по существу идентичные молекулы нуклеиновой кислоты гибридизируются друг с другом при соблюдении жестких условий (например, в пределах диапазона среды в жестких условиях).

«Выделенный» полипептид или полинуклеотид представляет собой такой, который является по существу свободным от материалов, с которыми он связан в природе. По существу свободный означает на по меньшей мере 50%, часто по меньшей мере 70%, более часто по меньшей мере 80% и даже более часто по меньшей мере 90% свободный от материалов, с которыми он связан в природе.

Смеси ферментов

Множество различных ферментов могут использовать в смесях ферментов и способах, описанных в настоящей заявке для сокращения биопленки. Смеси ферментов, описанные в настоящей заявке, включают по меньшей мере два фермента, такие как комбинации карбогидраз, такие как целлюлазы, эндоглюканазы, целлобиогидролазы и бета-глюкозидазы; амилазы, такие как альфа-амилазы; протеазы, такие как сериновые протеазы, например, субтилизины; эстеразы и кутиназы; ферменты, гидролизирующие гранулированный крахмал; липазы, такие как фосфолипазы; и гемицеллюлазы, такие как маннаназы. Такие смеси ферментов в настоящем описании также называют «смесью ферментов для удаления», и они включают комбинацию ферментов, как описано в настоящей заявке. В настоящей заявке описано, что смесь ферментов для удаления не включает фермент пергидролазу, но используется совместно с одним или более ферментами пергидролазы или одновременно, или последовательно в способе для сокращения биопленки.

Гидролазы (E.C.3.), которые могут использовать, включают, например, протеазы, глюканазы (семейство 16 гликозилгидролаз), целлюлазы, эстеразы, маннаназы и арабиназы. Нейтральные и сериновые протеазы, например, субтилизины, могут использовать в настоящем изобретении. Нейтральные протеазы представляют собой протеазы, которые имеют оптимальную протеолитическую активность при нейтральном диапазоне pH приблизительно 6-8. Подходящие нейтральные протеазы представляют собой аспартат и металлопротеазы. Коммерчески доступные металлопротеазы представляют собой MULTIFECT, PURAFECT L, FNA, PROPERASE L, PURADAX EG7000L и GC 106 из Aspergillus niger - все доступные от Genencor Division, Danisco US, Inc., Palo Alto ("Genencor"), California и Alcalase, Savinase, Esperase и Neutrase (Novo Nordisk A/S, Denmark). Нейтральные протеазы могут быть получены из бактериального, грибкового или дрожжевого источника, или растительного или животного источника и могут быть дикого типа или вариантными ферментами. Вариантные ферменты получены в источниках, которые экспрессируют гены, которые были мутированы из родительских генов.

Примеры целлюлаз, которые могут использовать в настоящем изобретении, включают эндоглюканазы, целлобиогидролазы и бета-глюкозидазы, включая целлюлазы, имеющие оптимальную активность при диапазоне pH от кислотного до нейтрального, например, PURADAX, полученный из бактериального источника, или LAMINEX и INDIAGE от Genencor, - оба, полученные из грибкового источника. Целлюлазы могут получить, например, из грибов родов Aspergillus, Trichoderma, Humicola, Fusarium и Penicillium.

Примеры пригодных ферментов, гидролизирующих гранулированный крахмал, включают глюкоамилазы, полученные из штаммов Humicola, Aspergillus и Phizopus. Ферменты, гидролизирующие гранулированный крахмал (GSH), относят к ферментам, которые гидролизируют крахмал в гранулированной форме. Глюкоамилаза относится к классу ферментов амилоглюкозидаз (например, EC.3.2.1.3 глюкоамилаза, 1,4-альфа-D-глюканглюкогидролаза). Они представляют собой экзо-активные ферменты, которые высвобождают глюкозильные остатки с невосстановленных концов молекул амилозы и амилопектина. Фермент также гидролизует альфа-1,6 и альфа-1,3 положения. Активность глюкоамилазы могут измерить, используя хорошо известные методы анализа, основываясь на способности глюкоамилазы катализировать гидролиз п-нитрофенил-альфа-D-глюкопиранозида (PNPG) до глюкозы и п-нитрофенола. При щелочном pH нитрофенол имеет желтый цвет, который является пропорциональным активности глюкоамилазы и измерен при 400 нм до сравнения со стандартом фермента, измеренным в качестве GAU. GAU (единица активности глюкоамилазы) определяют как количество фермента, которое производит 1 г восстановленного сахара, вычисленное как глюкоза в час из растворимого основания крахмала (4% пл.) при pH 4,2 и 60°C. Подходящие коммерчески доступные глюкоамилазы от Genencor включают OPTIDEX, DISTILLASE и G-ZYME.

Примеры липаз, которые могут использовать в настоящем изобретении, включают кислотные, нейтральные и щелочные липазы и фосфолипазы. Коммерчески доступные липазы и фосфолипазы от Genencor включают LYSOMAX и CUTINASE.

Примеры гемицеллюлазных маннаназ, которые могут использовать в настоящем изобретении, включают GC265 из Bacillus lentus, HEMICELL и PURABRITE - обе из Bacillus lentus от Genencor и маннаназы, описанные в Stahlbrand et al. (1993) J. Biotechnol. 29:229-242.

Примеры эстераз и кутиназ, которые могут использовать в настоящем изобретении, могут быть из любого источника, включая, например, бактериальные источники, такие как Pseudomonas mendocina, или грибковые источники, такие как Humicula или Fusarium. Некоторые из таких ферментов доступны от Genencor.

Примеры амилаз, которые могут использовать в настоящем изобретении, включают альфа- или бета-амилазы, которые могут получить из бактериальных или грибковых источников, таких как амилазы Bacillus (B. amyloliquefaciens, B. licheniformis и B. stearothermophilus) и грибковых амилаз, например, из Aspergillus, например, A. niger, A. kawachi или A. oryzae, Humicola и Trichoderma. Амилазы, доступные от Genencor, включают SPEZYME FRED, SPEZYME AA, CLARASE, AMYLEX и смесь амилаз SPEZYME ETHYL. Амилазы, доступные от Novozymes A/S (Дания), включают BAN, AQUAZYM, AQUAZYM Ultra и TERMAMYL. Другие амилазы включают смеси амилаз, такие как М1 от Biocon и CuConc от Sumizyme, Aris Sumizyme L (эндо 1,5 альфа-L арабиназа), ACH Sumizyme (бета-манназа), Humicola глюкоамилаза, декстраназа, декстрамаза, хитиназа, ENDOH и OPTIMAX L1000 (глюкоамилаза).

В находящейся в процессе одновременного рассмотрения заявке PCT № PCT/US2007/016461 проверили более 375 различных смесей ферментов на свойства удаления биопленки. Скрининг привел к определению 33 удивительных смесей ферментов, которые привели к значительному сокращению биопленки. 33 смеси ферментов включают смеси альфа-амилазы и маннаназы; амилазы и протеазы; амилазы и арабиназы; по меньшей мере одной альфа-амилазы и по меньшей мере двух других амилаз; протеазы, целлюлазы и глюканазы; протеазы, целлюлазы и трех глюканаз; протеазы, целлюлазы и маннаназы; протеазы, целлюлазы и амилазы; протеазы, амилазы и глюканазы; протеазы, маннаназы и амилазы; целлюлазы, арабиназы и амилазы; протеазы, целлюлазы, маннаназы и фосфолипазы; протеазы, глюканазы, амилазы и арабиназы; протеазы, целлюлазы и двух глюканаз; протеазы, целлюлазы и трех глюканаз; трех протеаз, целлюлазы, маннаназы и фосфолипазы; трех протеаз, целлюлазы, фосфолипазы и эстеразы; трех протеаз, маннаназы, фосфолипазы и эстеразы; трех протеаз, целлюлазы и маннаназы; двух протеаз, целлюлазы и глюканазы; двух протеаз, целлюлазы, глюканазы и маннаназы; двух протеаз, целлюлазы, глюканаз, фосфолипазы и маннаназы; по меньшей мере трех амилаз и целлюлазы; амилазы, арабиназы и целлюлазы; амилазы, арабиназы и протеазы; по меньшей мере трех амилаз и протеазы; по меньшей мере трех амилаз, протеазы и целлюлазы; глюканазы и смесь амилазы; целлюлазы и смесь амилазы.

В некоторых вариантах осуществления используют одну из следующих смесей ферментов: протеаза, глюканаза и эстераза; протеаза, глюканаза, эстераза и маннаназа; протеаза, глюканаза, фосфолипаза и маннаназа; три протеазы, глюканаза, фосфолипаза и маннаназа; три протеазы, фосфолипаза, эстераза и маннаназа; три протеазы, глюканаза и маннаназа; две протеазы, целлюлаза, глюканаза, фосфолипаза и маннаназа; протеаза, глюканаза и маннаназа; протеаза, целлюлаза, фосфолипаза и эстераза; две протеазы, глюканаза, фосфолипаза и эстераза; две протеазы, глюканаза, фосфолипаза и маннаназа; три протеазы, целлюлаза, фосфолипаза и глюканаза; три протеазы, целлюлаза, фосфолипаза и маннаназа; три протеазы, глюканаза, фосфолипаза и эстераза; протеаза, целлюлаза, глюканаза, фосфолипаза и эстераза; две или более амилаз и глюканаза; по меньшей мере три амилазы; по меньшей мере две амилазы, глюканаза и протеаза.

В некоторых вариантах осуществления используют одну из следующих смесей ферментов: протеаза, глюканаза и кутиназа, которую могут получить, используя коммерчески доступные ферменты MULTIFECT NEUTRAL; LAMINEX BG и кутиназа; протеаза, глюканаза, маннаназа и кутиназа, которую могут получить, используя коммерчески доступные ферменты MULTIFECT NEUTRAL; LAMINEX BG; маннаназа и кутиназа; протеаза, глюканаза, маннаназа и фосфолипаза, которую могут получить, используя коммерчески доступные ферменты MULTIFECT NEUTRAL; LAMINEX BG; маннаназа и LYSOMAX; смесь трех протеаз плюс целлюлаза, маннаназа и кутиназа, которую могут получить, используя коммерчески доступные ферменты PROPERASE L; PURAFECT L; FNA; и LAMINEX BG, маннаназа и кутиназа.

Некоторые варианты осуществления настоящего изобретения включают следующие коммерчески доступные получения фермента от Genencor: MULTIFECT NEUTRAL; LAMINEX; LYSOMAX; PROPERASE; PURADAX, PURAFECT; и SPEZYME, - все из которых зарегистрированы под торговой маркой Genencor.

MULTIFECT NEUTRAL содержит протеазу Bacillus amyloliquefaciens (EC3.4.24.28); LAMINEX BG, имеющий уровень активности приблизительно 3200 МЕ/г, включает В-глюканазу Trichoderma (целлюлаза EC3.3.1.6); LYSOMAX, имеющий уровень активности приблизительно 400 Е/г, содержит фосфолипазу Streptomyces violceoruber; PROPERASE, имеющий уровень активности приблизительно 1600 PU/г, содержит протеазу Bacillus alcalophilus (EC3.4.21.62); PURAFECT, имеющий уровень активности приблизительно 42,000 GSU/г, содержит субтилизин протеазу (EC3.4.21.62), как описано в патенте США № 5624829; FNA содержит протеазу Bacillus subtilis (EC3.4.21.62), как описано в патентах США № RE 34606 и 5310675; PURADAX, имеющий уровень активности приблизительно 32 Е/г, содержит целлюлазу Trichoderma reesei (EC3.2.1.4), как описано в патенте США № 5753484; SPEZYME FRED, имеющий уровень активности приблизительно 15,100 Ед/г, содержит альфа-амилазу из Bacillus licheniformis (EC3.2.1.1), как описано в Патенте США № № 5736499; 5958739; и 5824532.

В некоторых вариантах осуществления смеси ферментов, используя коммерчески доступные ферменты, включают следующие:

1. MULTIFECT NEUTRAL; LAMINEX BG и кутиназа.

2. MULTIFECT NEUTRAL; LAMINEX BG; маннаназа и кутиназа.

3. MULTIFECT NEUTRAL; LAMINEX BG; маннаназа и LYSOMAX.

4. PROPERASE L; PURAFECT L; FNA; LAMINEX BG, маннаназа и кутиназа.

5. PROPERASE L; PURAFECT L; FNA; маннаназа, кутиназа и LYSOMAX.

6. PROPERATE L; PURAFECT L, FNA, маннаназа, LAMINEX BG.

7. MULTIFECT NEUTRAL; LAMINEX BG; и маннаназа.

8. FNA; PURADAX EG 7000L; LAMINEX BG и кутиназа.

9. PURAFECT L; FNA; LAMINEX BG; и LYSOMAX.

10. PROPERASE L; FNA; LAMINEX BG; и LYSOMAX.

11. PROPERASE L; PURAFECT L; FNA; LAMINEX BG; PURADAX EG 7000L; и LYSOMAX.

12. PROPERASE L; PURAFECT L; FNA; LAMINEX BG; кутиназа и LYSOMAX.

13. MULTIFECT NEUTRAL; PURADAX EG 7000L; LAMINEX BG; LYSOMAX; и кутиназа.

14. PROPERASE L; LAMINEX BG; LYSOMAX и кутиназа.

В некоторых вариантах осуществления смеси ферментов представляют собой комбинации 1, 2, 3 и 4, упомянутые выше. Дополнительные комбинации ферментов включают: SPEZYME, который содержит альфа-амилазу, полученную из Bacillus licheniformis; CuCONC, который представляет собой торговую марку для штамма Кодзи глюкоамилазы Rhizopus niveus, который имеет гидролизирующую активность гранулированного крахмала (Shin Nihon Chemical Co. Ltd. Япония); AFP GC 106, который представляет собой кислотную грибковую протеазу (Shin Hihon Chemical Co. Ltd. Япония); М1, который является доступным от Biocon India, Ltd., Бангалор, Индия); ARIS SUMIZYME (1,5-альфа арабиназа); и ACH SUMIZYME.

15. SPEZYME FRED L; CuCON и LAMINEX BG.

16. SPEZYME FRED L; Aris SUMIZYME и LAMINEX BG.

17. SPEZYME FRED L и CuCONC.

18. SPEZYME FRED L; CuCONC и GC106.

19. SPEZYME FRED L и GC106.

20. SPEZYME FRED L и M1.

21. SPEZYME FRED L; Aris SUMIZYME и GC106.

22. SPEZYME FRED L; CuCONC; LAMINEX BG и GC106.

23. SPEZYME FRED L; ACH SUMIZYME и GC106.

24. SPEZYME FRED L; Aris SUMIZYME; LAMINEX BG и GC106.

25. CuCONC и LAMINEX BG.

26. SPEZYME FRED L и Aris SUMIZYME.

27. M1 и LAMINEX BG.

28. SPEZYME FRED L; LAMINEX BG и GC106.

29. CuCONC; LAMINEX BG и GC106.

Фермент пергидролаза

Выше описано, что один или более ферментов пергидролазы могут использовать в способах изобретения для удаления биопленки совместно со смесями ферментов.

В некоторых вариантах осуществления фермент пергидролаза встречается в природе (то есть фермент пергидролаза, кодируемый геномом клетки). В некоторых вариантах осуществления пергидролаза фермент содержит, состоит из или состоит по существу из аминокислотной последовательности, которая является по меньшей мере на приблизительно 80%, 85%, 90%, 95%, 97%, 98%, 99% или 99,5% идентичной аминокислотной последовательности фермента пергидролазы, встречающегося в природе.

В некоторых вариантах осуществления фермент пергидролаза представляет собой встречающийся в природе фермент пергидролазу M. smegmatis. В некоторых вариантах осуществления фермент пергидролаза содержит, состоит из или состоит по существу из аминокислотной последовательности, описанной в SEQ ID NO:1 или разновидности, или ее гомолога. В некоторых вариантах осуществления фермент пергидролаза содержит, состоит из или состоит по существу из аминокислотной последовательности, которая является по меньшей мере на приблизительно 80%, 85%, 90%, 95%, 97%, 98%, 99% или 99,5% идентичной аминокислотной последовательности, описанной в SEQ ID NO:1.

Аминокислотная последовательность пергидролазы M. smegmatis показана ниже:

MAKRILCFGDSLTWGWVPVEDGAPTERFAPDVRWTGVLAQQLGADFEVIEEGL

SARTTNIDDPTDPRLNGASYLPSCLATHLPLDLVIIMLGTNDTKAYFRRTPLDIAL

GMSVLVTQVLTSAGGVGTTYPAPKVLVVSPPPLAPMPHPWFQLIFEGGEQKTTE

LARVYSALASFMKVPFFDAGSVISTDGVDGIHFTEANNRDLGVALAEQVRSLL

(SEQ ID NO:1)

Соответствующая полинуклеотидная последовательность, кодирующая пергидролазу M. Smegmatis представляет собой:

5'-ATGGCCAAGCGAATTCTGTGTTTCGGTGATTCCCTGACCTGGGGCTGGGTCC

CCGTCGAAGACGGGGCACCCACCGAGCGGTTCGCCCCCGACGTGCGCTGGA

CCGGTGTGCTGGCCCAGCAGCTCGGAGCGGACTTCGAGGTGATCGAGGAGG

GACTGAGCGCGCGCACCACCAACATCGACGACCCCACCGATCCGCGGCTCA

ACGGCGCGAGCTACCTGCCGTCGTGCCTCGCGACGCACCTGCCGCTCGACCT

GGTGATCATCATGCTGGGCACCAACGACACCAAGGCCTACTTCCGGCGCACC

CCGCTCGACATCGCGCTGGGCATGTCGGTGCTCGTCACGCAGGTGCTCACCA

GCGCGGGCGGCGTCGGCACCACGTACCCGGCACCCAAGGTGCTGGTGGTCTC

GCCGCCACCGCTGGCGCCCATGCCGCACCCCTGGTTCCAGTTGATCTTCGAG

GGCGGCGAGCAGAAGACCACTGAGCTCGCCCGCGTGTACAGCGCGCTCGCG

TCGTTCATGAAGGTGCCGTTCTTCGACGCGGGTTCGGTGATCAGCACCGACG

GCGTCGACGGAATCCACTTCACCGAGGCCAACAATCGCGATCTCGGGGTGGC

CCTCGCGGAACAGGTGCGGAGCCTGCTGTAA-3' (SEQ ID NO:2)

В некоторых вариантах осуществления фермент пергидролаза содержит одно или более следующих замещений в одном или более положениях аминокислот, эквивалентных положению(ям) в аминокислотной последовательности пергидролазы M. smegmatis, описанной в SEQ ID NO:1. В некоторых вариантах осуществления фермент пергидролаза содержит любое одно или любую комбинацию замещений аминокислот, выбранных из M1, K3, R4, 15, L6, C7, D10, S11, L12, T13, W14, W16, G15, V17, P18, V19, D21, G22, A23, P24, T25, E26, R27, F28, A29, P30, D31, V32, R33, W34, T35, G36, L38, Q40, Q41, D45, L42, G43, A44, F46, E47, V48, I49, E50, E51, G52, L53, S54, A55, R56, T57, T58, N59, I60, D61, D62, P63, T64, D65, P66, R67, L68, N69, G70, A71, S72, Y73, S76, C77, L78, A79, T80, L82, P83, L84, D85, L86, V87, N94, D95, T96, K97, Y99 F100, R101, R102, P104, L105, D106, 1107, A108, L109, G110, M111, S112, V113, L114, V115, T116, Q117, V118, L119, T120, S121, A122, G124, V125, G126, T127, T128, Y129, P146, P148, W149, F150, I153, F154, I194 и F196.

В некоторых вариантах осуществления фермент пергидролаза содержит одно или более из следующих замещений в одном или более положениях аминокислоты, эквивалентных положению(ям) аминокислотной последовательности пергидролазы M. smegmatis, описанной в SEQ ID NO:1: L12C, Q или G; T25S, G или P; L53H, Q, G или S; S54V, L A, P, T или R; A55G или T; R67T, Q, N, G, E, L или F; K97R; V125S, G, R, A или P; F154Y; F196G.

В некоторых вариантах осуществления фермент пергидролаза содержит комбинацию замещений аминокислот в положениях аминокислоты, эквивалентных положениям аминокислоты аминокислотной последовательности пергидролазы M. smegmatis, описанной в SEQ ID NO:1: L12I S54V; L12M S54T; L12T S54V; L12Q T25S S54V; L53H S54V; S54P V125R; S54V V125G; S54V F196G; S54V K97R V125G; или A55G R67T K97R V125G.

В некоторых вариантах осуществления фермент пергидролаза имеет отношение пергидролиз:гидролиз по меньшей мере 1.

Оценка удаления биопленки

Удаление биопленки могут измерить с помощью анализа с кристаллическим фиолетовым. Образцы погружают в раствор кристаллического фиолетового (0,31% вес./об.) на десять минут до промывания три раза в фосфатно-солевом буфере (PBS) для удаления несвязанного окрашивающего вещества. Окрашивающее вещество, связанное с биопленкой, экстрагируют 95% этанолом и изучают абсорбцию раствора кристаллический фиолетовый/этанол при 540 нм. Процент удаления биопленки вычисляют как [(1 - Фракция оставшейся биопленки)×100]. Фракцию оставшейся биопленки вычисляют, вычитая абсорбцию среды + растворов фермента из абсорбции растворов, экстрагированных из биопленок, обработанных ферментом, разделенную на разницу в абсорбции необработанной контрольной биопленки минус абсорбции только среды роста.

Удаление биопленки могут также оценить суспендированием клеток из обработанной биопленки в буфере, таком как фосфатно-солевой буфер (PBS), высеванием клеток на чашку Петри в подходящую питательную среду роста и подсчетом числа клеток, которые растут в среде. Сокращение жизнеспособного числа клеток могут определить сравнением с числом клеток, которые вырастают из суспензии, полученным из необработанной контрольной биопленки.

Способы

Изобретение обеспечивает способы удаления биопленок с поверхностей. Удаление биопленки относится к сокращению или устранению биопленки с поверхности. Способы изобретения включают применение одного или более ферментов пергидролазы и смеси ферментов для удаления, как описано выше, к биопленке на поверхности при уровне дозировки фермента и в течение времени, достаточного для уменьшения биопленки на по меньшей мере приблизительно 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 96, 97, 98 или 99 процентов. Сокращение процента биопленки относится к сокращению числа жизнеспособных клеток в биопленке по сравнению с числом жизнеспособных клеток и/или общим числом клеток в биопленке до обработки. В некоторых вариантах осуществления биопленка, которую будут обрабатывать, содержит, состоит из или состоит по существу из Pseudomonas aeruginosa, Listeria monocytogenes или Staphylococcus aureus. Способы изобретения также включают профилактическое предотвращение образования или роста биопленки на поверхности.

В некоторых вариантах осуществления смесь ферментов для удаления выбирают из протеазы, глюканазы и эстеразы; протеазы, глюканазы, эстеразы и маннаназы; протеазы, глюканазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, фосфолипазы, эстеразы и маннаназы; трех протеаз, глюканазы и маннаназы; двух протеаз, целлюлазы, глюканазы, фосфолипазы и маннаназы; протеазы, глюканазы и маннаназы; протеазы, целлюлазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и эстеразы; двух протеаз, глюканазы, фосфолипазы и маннаназы; трех протеаз, целлюлазы, фосфолипазы и глюканазы; трех протеаз, целлюлазы, фосфолипазы и маннаназы; трех протеаз, глюканазы, фосфолипазы и эстеразы; протеазы, целлюлазы, глюканазы, фосфолипазы и эстеразы; двух или более амилаз и глюканазы; по меньшей мере трех амилаз; по меньшей мере двух амилаз, глюканазы и протеазы. В некоторых вариантах осуществления одну или более коммерчески доступных протеаз, выбранных из PROPERASE, PURAFECT, MULTIFECT NEUTRAL, FNA и GC 106, включают в смесь ферментов для удаления. В некоторых вариантах осуществления коммерчески доступную целлюлазу PURADAX включают в смесь ферментов для удаления. В некоторых вариантах осуществления коммерчески доступную эстеразу CUTINASE включают в смесь ферментов для удаления. В некоторых вариантах осуществления коммерчески доступную маннаназу, выбранную из GC265 и HEMICELL, включают в смесь ферментов для удаления. В некоторых вариантах осуществления коммерчески доступную глюканазу LAMIINEX BG включают в смесь ферментов для удаления. В некоторых вариантах осуществления эндо-арабиназу дополнительно включают в смесь ферментов для удаления.

В некоторых вариантах осуществления смесь ферментов для удаления включает три протеазы, глюканазу, фосфолипазу и маннаназу. В одном варианте осуществления протеазы представляют собой из Bacillus subtilis EC 3.3.2.6 и Bacillus alcalophilus EC 3.4.2.6, глюканаза представляет собой из разновидностей Trichoderma EC 3.3.1.6, фосфолипаза представляет собой из разновидностей Streptomyces EC 3.1.1.4, и маннаназа представляет собой из Bacillus lentus. В одном варианте осуществления смесь ферментов для удаления содержит или состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC265 и LYSOMAX.

В одном варианте осуществления пергидролаза представляет собой фермент пергидролазу из M. smegmatis (SEQ ID NO:1) или разновидность, или его гомолог.

Фермент(ы) пергидролазы и смесь ферментов для удаления могут применить к биопленке одновременно (при контакте с биопленкой в одно и то же время) или последовательно (при контакте с биопленкой в различное время). При одновременном использовании фермент(ы) пергидролазы и смесь ферментов для удаления могут добавить из единичной композиции, которая содержит все ферменты, или из отдельных композиций, содержащих пергидролазу и смесь ферментов для удаления.

В некоторых вариантах осуществления применение фермента(ов) пергидролазы осуществляют последовательно, причем пергидролазу добавляют сначала и смесь ферментов для удаления добавляют потом. В одном варианте осуществления пергидролазу применяют к биопленке, удаляют из биопленки и затем смесь ферментов для удаления применяют к биопленке. В некоторых вариантах осуществления смесь ферментов для удаления добавляют от через приблизительно 15 до приблизительно 60 минут, например, приблизительно 15, 30, 45 или 60 минут, после того как удаляют фермент пергидролазу.

В одном варианте осуществления смесь ферментов для удаления содержит или состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC265 и LYSOMAX, и пергидролаза представляет собой фермент пергидролазу из M. smegmatis (SEQ ID NO:1), пергидролазу и смесь ферментов для удаления добавляют последовательно и фермент пергидролазу добавляют до смеси ферментов для удаления.

В некоторых вариантах осуществления субстраты для фермента пергидролазы включают в композицию, содержащую пергидролазу, которую применяют к биопленке. Например, диацетат пропиленгликоля (PGD) и перкарбонат могут включить, когда пергидролазу применяют к биопленке.

Эффекты пергидролазы и смесь ферментов для удаления на биопленку могут быть аддитивными (то есть степень удаления биопленки приблизительно - сумма удаления с пергидролазой отдельно и удаления со смесью ферментов отдельно) или синергетическими (то есть степень удаления биопленки больше, чем сумма удаления с пергидролазой отдельно и удаления со смесью ферментов отдельно).

В некоторых вариантах осуществления смесь ферментов для удаления содержит от приблизительно 1 вес.% до приблизительно 6 вес.% общего количества ферментов. В некоторых вариантах осуществления фермент пергидролазу используют при концентрации от приблизительно 0,01 вес.% до приблизительно 0,0001 вес.%.

Наборы

Изобретение также обеспечивает наборы. В настоящей заявке описано, что наборы включают фермент пергидролазу и смесь ферментов для удаления в количествах, достаточных для использования в способе для обработки биопленки. В одном варианте осуществления фермент пергидролаза и смесь ферментов для удаления находятся в отдельных емкостях. В другом варианте осуществления фермент пергидролаза и смесь ферментов для удаления находятся в одной емкости. Смесь ферментов для удаления может содержать любую из комбинаций ферментов, описанных выше. В настоящей заявке описано, что фермент пергидролаза может содержать, состоять из или состоять по существу из аминокислотной последовательности, описанной в SEQ ID NO:1, или разновидности, или ее гомолога. Ферменты, обеспеченные в комплекте, могут поставлять в твердой или жидкой форме. Набор может дополнительно включать буферные растворы, субстраты или другие подходящие компоненты для ферментативной активности и/или стабильности. Например, набор может содержать субстраты для активности пергидролазы, например, диацетат пропиленгликоля (PGD) и перкарбонат. В настоящей заявке описано, что набор может включать инструкции по применению в способе для обработки биопленки.

Подходящую упаковку обеспечивают. Используемая в настоящем описании «упаковка» относится к твердой матрице или материалу, обычно используемому в системе и способному к удерживанию в неподвижных пределах одного или более компонентов набора, описанных в настоящей заявке, например, ферментов, буферных растворов, субстратов. Такие материалы включают стекло и пластмассу (например, полиэтилен, полипропилен и поликарбонат) бутылки, пробирки, бумагу, пластмассу и многослойные оболочки полимерной пленки и подобные. При использовании методики электронно-лучевой стерилизации упаковка должна иметь достаточно низкую плотность для возможности стерилизации содержимого.

Инструкции могут быть предоставлены в печатной форме или в электронной форме, такой как дискета, CD или DVD, или в форме адреса вебсайта, где могут быть получены такие инструкции.

Следующие примеры представлены для иллюстрации, но не ограничения изобретения.

ПРИМЕРЫ

Пример 1

Скрининг смесей ферментов для удаления биопленок Pseudomonas aeruginosa

Общая экспериментальная модель

Способ с высокой производительностью использовали для скрининга большого количества смесей ферментов, основываясь на разработанной исследуемой матрице ферментов. PBS и ацетатные буферы применяли для получения раствора (Трис-буфер: pH 7,0 или 8,5 и ацетатный буфер: pH 5,0). Различные комбинации смесей ферментов создавали согласно pH и температурным параметрам ферментов. Таблица, содержащая все 375 различные комбинации, включена в качестве Приложения A. 96-луночный способ применяли для скрининга 375 различных комбинаций ферментов с 4 репликами для каждой. Этот анализ учитывал образование биопленок в лунках 96-луночных микротитровальных планшетов, которые могут быть использованы для обеспечения до 96 различных испытательных образцов.

Бактериальный инокулят (Pseudomonas aeruginosa, РО1, образующий биопленку) выращивали в триптическом соевом бульоне (TSB) при 21°C в течение ночи во встряхиваемой колбе. 20 мл этого бульона затем добавляли к 180 мл другого свежего триптического соевого бульона в другой встряхиваемой колбе. 200 мкл этого разбавленного инокулята затем добавляли в каждую лунку 96-луночного планшета, используя 96-игольчатую пипетку-репликатор. Каждые 8-10 часов питательные вещества, планктонные клетки и среды удаляли из полости и заменяли свежей средой TSB. Биопленки выращивали в лунках в течение 24 часов при 21°C.

После образования биопленки среды удаляли из лунок 96-луночного планшета и различные ферменты и контрольные растворы для обработки переносили в лунки планшета. Биопленки выдерживали в течение данного периода времени (90 минут использовали для этого исследования). Лунки затем дважды промывали деионизированной водой для удаления любого оставшегося раствора для обработки и клетки суспендировали из системы. Биопленку затем окрашивали с помощью кристаллического фиолетового в течение 10 минут. Каждую лунку промывали 4 раза для удаления любого избытка красителя из системы и затем элюировали 300 мкл этанола. Стадия промывания улучшала обнаружение красителя в течение исследований. Планшет затем немедленно прочитывали с помощью аппарата для чтения титрационного микропланшета (J. Microbiological Methods (2003) 54:269-276). Все обработки проводили по меньшей мере с 4 репликами. В условиях скрининга контроли обесцвечивания имели 75% сокращение при pH 7,0, 75% при pH 5,0 и 93% при pH 8.

Удаление биопленки при кислотных условиях pH

Определенные ферменты, такие как протеазы, липазы, целлюлазы и другие карбогидразы, которые являются каталитически эффективными для гидролитических реакций при кислотных условиях (pH 5), подвергали скринингу для определения их эффективности при удалении биопленки. Например, GC 106 кислую протеазу использовали в этом исследовании в комбинации с липазами, целлюлазами и другими карбогидразами, которые являются каталитически эффективными при кислотных условиях. 17 комбинаций ферментов, подвергнутых скринингу из этого исследования, достигали 69-88% удаления биопленки.

Удаление биопленки при нейтральных условиях pH

Определенные ферменты, такие как протеазы, липазы, целлюлазы и карбогидразы, которые являются каталитически эффективными для гидролитических реакций при нейтральных условиях (pH 7), отбирали для скрининга их эффективности при удалении биопленки. Например, нейтральную протеазу использовали в этом исследовании в комбинации с липазами, целлюлазами и другими карбогидразами, которые являются каталитически эффективными при нейтральных условиях. 5 комбинаций ферментов, подвергнутых скринингу из этого исследования, достигали 71-84% удаления биопленки.

Удаление биопленки при основных условиях pH

Определенные ферменты, такие как щелочные протеазы, липазы, целлюлазы и другие карбогидразы, которые являются каталитически эффективными для гидролитических реакций при щелочных условиях (pH 8,4), отбирали для скрининга их эффективности при удалении биопленки. Например, сериновые протеазы, такие как FNA, PURAFECT и PROPERASE использовали в этом исследовании в комбинации с липазами, целлюлазами и другими карбогидразами, которые являются каталитически эффективными при основных условиях. 11 комбинаций фермента, подвергнутых скринингу из этого исследования, достигали 70-80% удаления биопленки.

Статистический анализ данных

Данные проанализировали на уровень статистической значимости. Анализ отклонений определенных смесей ферментов показан ниже в таблице 1, который статистически отличается от контроля. Вероятность ошибки с поправкой на эффект множественных сравнений была установлена при 0,05; то есть 95% уверенность, что не будет никаких ложных положительных результатов в одном наборе 143 тестируемых результатов. Подробности этого способа статистического анализа могут быть обнаружены в http://core.ecu.edu/psvc/wuenschk/docs30/multcomp.doc, и идея хорошо проиллюстрирована в http://www.brettscaife.net/statistics/introstat/08multiple/lecture.html.

Результаты

Эффективные смеси ферментов для удаления биопленки по меньшей мере на 40% биопленки перечислены в таблице 1 в их порядке уменьшения для каждого из различных наборов ферментов.

Таблица 1

Удаление биопленки различными комбинациями ферментов
Комбинация ферментовПроцент удаления Условия
Контроль обесцвечивания93 Основные
Рер 3, Cel 2, Pal 2 84Основные
Рер 3, Cel 2, Car 1, Pal 2 82Основные
Рер 3, Cel 2, Car 1, Pal 180 Основные
Pep 1,2,4, Cel 2, Car 1, Pal 180Основные
Pep 1,2,4, Car 1, Pal 1, Pal 2 78Основные
Рер 1,2,4, Cel 2, Car 1 77Основные
Pep 2,4, Cel 1, Cel 2, Car 1, Pal 176 Основные
Pep 4, Cel 1, Pal 1, Pal 275 Основные
Pep 2,4, Cel 2, Pal 1 75Основные
Pep 1,4, Cel 2, Car 1, Pal 1 74Основные
Контроль обесцвечивания75 Нейтральные
Pep 1,2,4, Cel 1, Cel 2, Pal 172Нейтральные
Pep 1,2,4, Cel 1, Car 1, Pal 1 72Нейтральные
Pep 1,2,4, Cel 2, Pal 1, Pal 2 72Нейтральные
Pep 3, Cel 1, Cel 2, Pal 1, Pal 2 72Нейтральные
Pep 1,4, Cel 2, Pal 1, Pal 2 70Нейтральные
Контроль обесцвечивания75 Кислотные
Car 2&7, Cel 2 88Кислотные
Car 2&4, Cel 2 83Кислотные
Car 2&781 Кислотные
Car 2&7, Pep 5 81Кислотные
Car 2, Pep 581 Кислотные
Car 2&678Кислотные
Car 2&4, Pep 5 78Кислотные
Car 2&7, Cel 2, Pep 577 Кислотные
Car 2&5, Pep 5 77Кислотные
Car 2, Cel 275 Кислотные
Car 2, Car 7&4 74 Кислотные
Car 6&4, Cel 2 75Кислотные
Car 2, Cel 2, Pep 5 72Кислотные
Car 7, Cel 2, Pep 572 Кислотные
Car 2&6, Cel 2 69Кислотные
Car 2&5, Cel 2, Pep 5 69Кислотные

Таблица 2

Разъяснения для ферментов в смесях, показанных в таблице 1
КодНазвание фермента Тип фермента
CAR1 GC265Маннаназа
CAR2SPEZYME FRED-L Альфа-амилаза
CAR4 ARIS SUMIZYME1,5-альфа L арабиназа
CAR5ACH SUMIZYME Бета-маннаназа
CAR6BIOCON Ml Смесь амилаз
CAR7 CUCONC SUMIZYMEСмесь амилаз
CEL1PURADAX Целлюлаза
CEL2LAMINEX BG Глюканаза
PAL1 LYSOMAXФосфолипаза
PAL2CUTINASEЭстераза
PEP1PROPERASE Протеаза
PEP2 PURAFECTПротеаза
PEP3MULTIFECT NEUTRALПротеаза
PEP4FNAПротеаза
PEP5GC106 Протеаза

Данные, обеспеченные способом с высокой производительностью, были полезны для скрининга большого количества смесей. Дальнейшее исследование возможных смесей затем проводили для подтверждения их эффективности в отношении биопленок, включая биопленки Pseudomonas aeruginosa, Listeria monocytogenes, Staphylococcus aureus и объединение биопленок питьевой воды, как описано в примерах ниже.

Пример 2

Оценка таблицы 1 смеси ферментов в CDC биопленочном реакторе

Экспериментальный способ

Смеси ферментов в таблице 1 оценивали на удаление биопленки, используя лабораторную модельную систему, CDC Биопленочный Реактор (модель CBR 90, Biosurface Technologies Corporation, Bozeman, MT). Эта система была разработана Центром по контролю за заболеваниями и использовалась для изучения биопленок, образованных различными видами бактерий. CDC Биопленочный Реактор состоит из однолитрового сосуда с восемью полипропиленовыми держателями пластинок (coupons), вставленными в крышку. Каждый держатель пластинки может иметь три пластинки диаметра 0,5 дюйма с образцом. Для экспериментов, о которых сообщают в настоящем описании, пластинки для образцов создавали из полистирола, что сопоставимо с анализом скрининга высокой производительности, который проводили, используя полистирольные титрационные микропланшеты. Двумя CDC биопленочными реакторами управляли параллельно, обеспечивая в общей сложности 48 пластинок для образцов в эксперименте. Жидкую среду роста вводили через верхнюю часть сосуда и выводили через одностороннее выходное отверстие. Магнитная мешалка, включающая лопастной смеситель, обеспечивала смешивание жидкости и сдвиг поверхности.

Биопленка Pseudomonas aeruginosa

Сосуды CDC Биопленочного Реактора с рабочим объемом приблизительно 400 мл, содержащие 10% концентрации триптический соевый бульон, инокулировали с P. aeruginosa и работали в периодическом режиме (без вливания среды) в течение 6 часов при 37°C. После установления периодической культуры поток среды при скорости 600 мл/час обеспечивали в течение дополнительных 42 часов для установления биопленок P. aeruginosa на полистирольных пластинках с образцами. В конце периода роста биопленки шесть контрольных пластинок удаляли из каждого из этих двух реакторов и промывали стерильным фосфатно-солевым буфером (PBS) для удаления не присоединенных бактерий. Три пластинки из каждого реактора затем проанализировали на содержание биопленки, используя способ окрашивания с помощью кристаллического фиолетового, описанного ниже. Оставшиеся три контрольные пластинки из каждого реактора обрабатывали ультразвуком в PBS, последовательно разбавленном, и помещали на триптический соевый агар для вычисления числа поддающихся культивированию бактерий в пределах биопленки.

Оставшиеся 30 тестируемых пластинок и 6 контрольных пластинок переносили в 12-луночные планшеты, содержащие культуры клеток ткани, и обрабатывали выбранными высокопроизводительными смесями ферментов, используемыми в дозировке фермента 1 вес.% общего количества фермента в буфере в течение 90 минут при 45°C. Шесть контрольных пластинок обрабатывали тем же самым буфером, используемым для получения смесей ферментов. После обработок пластинки промывали три раза PBS и анализировали на присутствие биопленки, используя способ окрашивания кристаллическим фиолетовым. Этот способ состоял из погружения пластинок в раствор кристаллического фиолетового (0,31% вес./об.) в течение десяти минут, промывая пластинки три раза PBS для удаления несвязанного красителя. Связанный краситель затем экстрагировали из биопленки, используя 95% этанол, и абсорбцию раствора кристаллический фиолетовый/этанол изучали при 540 нм. Процент удаления биопленки Pseudomonas вычисляли как [(1 - Фракция оставшейся биопленки)×100]. Фракцию оставшейся биопленки вычисляли, вычитая абсорбцию среды + растворов фермента из абсорбции растворов, экстрагированных из биопленок, обработанных ферментом, разделенную на разницу в абсорбции необработанной контрольной биопленки и абсорбции только среды роста. Средняя толщина биопленки представляла собой 0,2 мм.

Процент удаления биопленки, оцененный используя биопленки, выращенные в CDC-BR, был в некоторой степени ниже, чем определенный предварительно, используя скрининг высокой производительности (HTA), как показано ниже в таблице 3. Это происходит, вероятно, вследствие более прочной природы биопленок, выращенных в CDC-BR. CDC-BR создает более высокий сдвиг окружающей среды, чем способ с 96-луночным титрационным микропланшетом, используемый для HTA, который, вероятно, привел к более сложному удалению биопленок. Тем не менее удаление до 77% биопленки наблюдали с некоторыми из комбинаций ферментов. Комбинация «Pep 1,2,4, Cel 2, Car 1, Pal 1» заняла девятое место в тестах HTA при 80% удалении, но была лучше, чем любая другая комбинация на CDC-BR биопленках с 77% удалением. Самый высокий процент удаления биопленки наблюдали для смесей ферментов, приготовленных в щелочном буфере (50 мМ Бис-Трис, pH 8,5).

Таблица 3

Результаты тестов удаления биопленки, используя биопленки Pseudomonas aeruginosa, выращенные в CDC биопленочном реакторе
Комбинация ферментаHTA % Удалениеспособ ферментативного удаления биопленки, композиция и набор, патент № 2495098 CDC-BR % Удаление CDC-BR Ст. Откл.CDC-BR n
Контроль обесцвечивания 75-9375-93способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
Pep 3, Cel 2, Pal 2 8451 154
Pep 3, Cel 2, Car 1, Pal 282 61194
Pep 3, Cel 2, Car 1, Pal 1 805117 4
Pep 1,2,4, Cel 2, Car 1, Pal 18077 53
Pep 1,2,4, Car 1, Pal 1, Pal 278 73133
Pep 1,2,4, Cel 2, Car 1 77757 3
Pep 2,4, Cel 1, Cel 2, Car 1, Pal 17658 133
Pep 3, Cel 2, Car 176 51263
Pep 4, Cel 1, Pal 1, Pal 2 75664 3
Pep 2,4, Cel 2, Pal 1 7563 83
Pep 1,4, Cel 2, Car 1, Pal 174 59233
Pep 1,2,4, Cel 1, Car 1, Pal 1 72749 3
Pep 1,2,4, Cel 2, Pal 1, Pal 27258 283
Pep 3, Cel 1, Cel 2, Pal 1, Pal 271 609 4
Car 2&4,Cel 2 83675 3
Car 2&7 815111 2
Car 2&7, Pep 5 813725 3
Car 2, Pep 5 813532 2
Car 2&6 781520 2
Car 2&4, Pep 5 78284 2
Car 2&7, Cel 2, Pep 5 7735 n/a1
Car 2&5, Pep 577 31n/a1
Car 2&4, Cel 2, Pep 5 7724n/a 1
Car 7, Cel 2 753633 3
Car 2&4 755012 3
Car 6, Cel 2 74264 2
Car 2, Cel 2, Pep 5 7297 2
Car 7, Cel 2, Pep 5 725418 3

Испытание 30 смесей ферментов, используя систему CDC биопленочного реактора с Pseudomonas aeruginosa обнаружило двадцать смесей ферментов с удалением биопленки более чем на 40%, 19 смесей с процентом удаления биопленки более чем на 50%, 10 смесей с процентом удаления биопленки более чем на 60% и 4 смеси выше 70%. Обнаружено, что большинство смесей ферментов представляют собой наиболее эффективные для удаления биопленки Pseudomonas в условиях от щелочных до нейтральных, исходя из как HTP, так и базируемого на CDC реакторе анализа удаления биопленки Pseudomonas aeruginosa. При кислотных условиях самой высокопроизводительной обнаруженной смесью являлась Car2+Car7+Cel2. Cel2 обнаружили в большинстве эффективных смесей ферментов, протестированных для удаления биопленки Pseudomonas.

Пример 3

Упомянутые ниже смеси ферментов тестировали для оценки эффективности в отношении трех других главных коммерчески подходящих биопленок, основываясь на данных CDC биопленочного реактора на Pseudomonas и отдельном исследовании HTP на дентальной биопленке, четыре разновидности моделей. Из практических соображений относительно времени, доступного для очистки и экономии дозировки, время взаимодействия очищающей смеси ферментов с пластинками биопленки уменьшали до 40 минут и окончательную объединенную концентрацию ферментов всех компонентов ферментов в смесях ферментов ограничивали в общей сложности до 1%. Например, смесь ферментов PEP5+CAR2+CEL3 содержала 0,33+0,33+0,34% каждого фермента, создавая окончательную дозировку смеси ферментов для тестирования 1%.

Тестирование проводили при трех pH, упомянутых ниже, используя шесть смесей ферментов, упомянутых ниже. Тесты проводили на биопленках Listeria, Staphylococcus и питьевой воды. Результаты представлены в примерах 4-6.

pH 5,5

1. PEP5+CAR2+CEL3

2. PEP5+CAR2+CEL2

pH 7,0

3. PEP6+PAL2+CEL3

4. PEP3+PAL2+CEL2

pH 8,5

5. PEP1+PEP2+PEP4+CEL2+CAR1+PAL1

6. PEP4+CEL1+PAL1+PAL2

Наиболее эффективной смесью ферментов для всех типов удаления биопленки была комбинация FNA, Purafect L, Properase L, Laminex BG, GC265 и Lysomax при мягких щелочных условиях. Для условий от нейтрального до кислого pH самая эффективная смесь ферментов включала Multifect Neutral, Laminex BG и ферменты Кутиназы.

Пример 4

Биопленка Listeria monocytogenes

Сосуды CDC биопленочного реактора, имеющие пластинки из нержавеющей стали с рабочим объемом приблизительно 400 мл, содержащие 10% концентрации среду с сердечно-мозговым экстрактом (BHI) инокулировали с 4 мл краткосрочной культуры Listeria monocytogenes (ATCC 19112) в 10% BHI при 37°C. Реактором управляли в периодическом режиме в течение 24 часов с последующей непрерывной подачей потока среды BHI при 7 мл/мин в течение следующих 24 часов. После 48 часов (24 часа периодический режим + 24 часа непрерывный режим) реактор останавливали и демонтировали.

Стерильный пинцет использовали для удаления всех пластинок из нержавеющей стали из палочек, касаясь передней и задней части пластинок как можно меньше, и пластинки помещали в стерильные 12-луночные планшеты для обработки.

В общей сложности 24 пластинки на реактор были доступны и три пластинки каждого обрабатывали каждой комбинацией смеси ферментов (шесть комбинаций, общая 1% концентрация смеси ферментов всех объединенных компонентов фермента, 40 минут, 45°C). Три пластинки не обрабатывали и использовали в качестве необработанного контроля. Все обработанные пластинки удаляли из обработки, промывали три раза PBS и помещали в 75% раствор кристаллического фиолетового в двенадцатилуночный планшет на десять минут. После окрашивания пластинки промывали три раза PBS, и помещали в 5,0 мл 95% этанола, и устанавливали на шейкер при комнатной температуре на 5 минут для элюирования кристаллического фиолетового. Элюированные растворы затем капали из пипетки в кюветы и изучали на спектрофотометре при 540 нм. Процент удаления биопленки Listeria вычисляли из [(1 - Фракция оставшейся биопленки)×100]. Фракцию оставшейся биопленки вычисляли, вычитая абсорбцию среды + растворов фермента из абсорбции растворов, экстрагированных из биопленок, обработанных ферментом, и делили на разницу в абсорбции необработанных контрольных биопленок и абсорбции только среды роста.

Таблица 4

Удаление биопленок Listeria смесями ферментов в CDC реакторе
Комбинация ферментов CDC-BR % удалениеCDC-BR Ст. откл. CDC-BR n
Контроль обесцвечивания

(Основный)
93способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
Контроль обесцвечивания

(Нейтральный)
75 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
Контроль обесцвечивания

(Кислотный)
75 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
PEP5+CAR2+CEL3 3983
PEP5+CAR2+CEL2 30353
PEP3+PAL2+CEL2 4023
PEP6+PAL2+CEL3 41103
PEP4+CEL1+PAL1+PAL2 51213
PEP1+PEP2+PEP4+CEL2+CAR1+PAL1 56133

Пример 5

Биопленка Staphylococcus aureus

Сосуды CDC биопленочного реактора, имеющие полиуретановые пластинки с рабочим объемом приблизительно 400 мл, содержащие 10% среду триптического соевого бульона (TSB) инокулировали с 4 мл краткосрочной культуры Staphylococcus aureus (SRWC-10943) в 10% среде TSB при 37°C. CDC реактором управляли в периодическом режиме в течение 24 часов с последующей непрерывной подачей потока среды TSB при 7 мл/мин в течение следующих 24 часов. После 48 часов (24 часа периодический режим + 24 часа непрерывный режим) реактор останавливали и демонтировали.

Стерильный пинцет использовали для удаления всех полиуретановых пластинок из палочек, касаясь передней и задней части пластинок как можно меньше, и пластинки помещали в стерильные 12-луночные планшеты для обработки.

В общей сложности 24 пластинки на реактор были доступны, и каждую из трех пластинок каждого обрабатывали каждой комбинацией смеси ферментов (шесть комбинаций, общая 1% концентрация смеси ферментов всех объединенных компонентов фермента, 40 минут, 45°C). Три пластинки не обрабатывали и использовали в качестве необработанного контроля. Все обработанные пластинки удаляли из обработки, промывали три раза PBS и помещали в 75% раствор кристаллического фиолетового в двенадцатилуночный планшет на десять минут. После окрашивания пластинки промывали три раза PBS, и помещали в 5,0 мл 95% этанола, и устанавливали на шейкер при комнатной температуре на 5 минут для элюирования кристаллического фиолетового. Элюированные растворы затем капали из пипетки в кюветы и изучали на спектрофотометре при 540 нм. Процент удаления биопленки Listeria вычисляли из [(1 - Фракция оставшейся биопленки)×100]. Фракцию оставшейся биопленки вычисляли, вычитая абсорбцию среды + растворов фермента из абсорбции растворов, экстрагированных из биопленок, обработанных ферментом, и делили на разницу в абсорбции необработанных контрольных биопленок и абсорбции только среды роста.

Таблица 5

Удаление биопленок Staphylococcus aureus смесями ферментов в CDC реакторе
Комбинация ферментов CDC-BR % удалениеCDC-BR

Ст. откл.
CDC-BR n
Контроль обесцвечивания (Основный, Нейтральный, Кислотный) 93,75,75способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
PEP5+CAR2+CEL3 2583
PEP5+CAR2+CEL2 30103
PEP3+PAL2+CEL236 83
PEP6+PAL2+CEL332 193
PEP4+CEL1+PAL1+PAL2 2818 3
PEP1+PEP2+PEP4+CEL2+CAR1+PAL1 418 3

Пример 6

Объединение биопленки питьевой воды

20 л стерильную бутыль с 19 л питьевой воды BAC/GAC (содержащей низкий КОЕ объединения смешанной питьевой воды) и 1 л раствора дополнительного углерода получали со следующими ингредиентами для достижения дополнительной концентрации углерода:

L-глутаминовая кислота 0,0047 г/л

L-аспарагиновая кислота 0,0053 г/л

L-серин 0,0055 г/л

L-аланин 0,0047 г/л

D+ глюкоза 0,0048 г/л

D+ галактоза 0,0048 г/л

D-арабиноза 0,0048 г/л

Стерильные CDC реакторы помещали в ламинарный шкаф и заполняли на выходе водой BAC/GAC. В инкубаторе при 37°C соединили все входные и выходные отверстия, и CDC реакторы поместили на пластину для смешивания. Реакторами управляли в течение 24 часов в периодическом режиме с последующим непрерывным потоком воды BAC/GAC, дополненной углеродом, при 7 мл/мин в течение следующих 24 часов. По истечении 48 часов (24 часа - периодический режим + 24 часа - непрерывный режим) прекращали поступление потока, среду выливали из реакторов в контейнер для отходов и реакторы помещали в ламинарный шкаф.

Используя стерильный пинцет, все пластинки удаляли из палочек. ПВХ пластинки, содержащие объединения биопленок питьевой воды затем помещали в стерильные 12-луночные планшеты для обработки.

В общей сложности 24 пластинки на реактор были доступны и три пластинки каждого обрабатывали каждой комбинацией смеси ферментов (семь комбинаций, общая 1% концентрация смеси всех ферментов, 40 минут, 45°C). Три пластинки не обрабатывали и использовали в качестве необработанного контроля. Все обработанные пластинки удаляли из обработки, промывали три раза PBS и помещали в 75% раствор кристаллического фиолетового в двенадцатилуночный планшет на десять минут. После окрашивания пластинки промывали три раза PBS и помещали в 5,0 мл 95% этанола, и устанавливали на шейкер при комнатной температуре на 5 минут для элюирования кристаллического фиолетового. Элюированные растворы затем капали из пипетки в кюветы и изучали на спектрофотометре при 540 нм. Процент удаления биопленки Listeria вычисляли как [(1 - Фракция оставшейся биопленки)×100]. Фракцию оставшейся биопленки вычисляли, вычитая абсорбцию среды + растворов фермента из абсорбции растворов, экстрагированных из биопленок, обработанных ферментом, и делили на разницу в абсорбции необработанных контрольных биопленок и абсорбции только среды роста.

Таблица 6

Удаление биопленок объединения питьевой воды смесями ферментов в CDC реакторе
Комбинация ферментов CDC-BR % удалениеCDC-BR

Ст. откл.
CDC-BR n
Контроль обесцвечивания (Основный, Нейтральный, Кислотный) 93,75,75способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
PEP5+CAR2+CEL3 7294
PEP5+CAR2+CEL212 184
PEP3+PAL2+CEL247 224
PEP6+PAL2+CEL343 164
PEP4+CEL1+PAL1+PAL253 84
PEP1+PEP2+PEP4+CEL2+CAR1+PAL1 598 4

Пример 7

Удаление биопленок смесями ферментов и ферментом пергидролазой

Способы

CDC биопленочные реакторы (http://www.imt.net/~mitbst/CDCreactor.html) в стерильных условиях заполняли соответствующей средой плюс 4,0 мл одного из следующих инокулятов:

- Краткосрочная культура Pseudomonas aeruginosa в 10% триптическом соевом бульоне (TSB). Пластинки для этой серии были из полистирола.

- Краткосрочная культура Listeria monocytogenes (ATCC 19112) в 10% сердечно-мозговом настое (BHI). Пластинки для этой серии были из нержавеющей стали.

- Объединения питьевой воды в воде с дополнительным углеродом. Пластинки для этой серии были из поливинилхлорида (ПВХ).

Для культур Pseudomonas и Listeria реакторы инкубировали при 37°C в течение 24 часов в периодическом режиме. При T=24 часа вводили непрерывный поток при 7 мл/мин в течение следующих 24 часов. Испытание проводили на пластинках при T=48 часов (24 часа - периодический режим + 24 часа - непрерывный режим).

Биопленки с питьевой водой были коричневые при комнатной температуре на столе при периодическом режиме в течение 48 часов с последующим непрерывным потоком в течение 24 часов. Пластинки питьевой воды проверяли при T=72 часа (48 часов - периодический режим + 24 часа - непрерывный режим).

Обработка фермента

Пластинки помещали в стерильные 12-луночные планшеты для обработки фермента. Следующие обработки проводили:

- фермент пергидролаза с последующей смесью PEP1, PEP2, PEP4, CEL2, CAR1 и PAL1 («смесь ферментов для удаления»)

- смесь ферментов для удаления с последующей обработкой ферментом пергидролазой

- ферментом пергидролазой отдельно

Каждую из шести пластинок подвергали одной из вышеперечисленных обработок ферментами или стерильным фосфатно-солевым буфером (PBS) в качестве контроля. Время обработки было 90 минут (45 минут - смесью ферментов для удаления и 45 минут- ферментом пергидролазой) при 45°C или 45 минут при 45°C, когда фермент пергидролазу использовали отдельно. По окончании времени обработки пластинки удаляли из раствора обработки и промывали три раза PBS.

Раствор ферментов для удаления: PEP1, PEP2, PEP4, CEL2, CAR1 и PAL1 при окончательной концентрации ферментов для каждого фермента 1% в 50 мМ Трис, pH 8,5.

Раствор для фермента пергидролазы, окончательная концентрация: 100 мМ диацетата пропиленгликоля (PGD), 100 мМ перкарбоната, 4 м.д. S54V разновидность SEQ ED NO:1, 400 мМ KH2PO4, pH 7,1.

Исходный раствор для пергидролазы: 125 мМ PGD - 2 мл/100 мл 400 мМ KH2PO4 (800 мкл на 1 мл реакционной смеси); 10,5 мг/мл перкарбоната (10,5 мг на 1 мл реакционной смеси); 20 м.д. пергидролазы (200 мкл на 1 мл реакционной смеси).

Методика обработки пергидролазы: перкарбонат взвешивали и смешивали с буфером PGD/KH2PO4 для растворения. (Альтернативно, другой подходящий буфер могут применять при pH 6-12 или не добавлять буфер, используя перкарбонат в качестве буфера). Добавляли пергидролазу и раствор снова смешивали. Раствор выдерживали в течение 20 минут при комнатной температуре, затем немедленно использовали.

Раствор перуксусной кислоты для анализа: 50 мл 125 мМ Na-цитратного буфера, pH 5,0, 500 мкл 100 мМ соль диаммония 2,2'-азино-бис(3-этилбензотиазолин-6-сульфоновой кислоты) CAS# 30931-67-0 (ABTS) в воде, 100 мкл 25 мМ KI в воде.

Методика анализа перуксусной кислотой: 25 мкл раствора фермента пергидролазы смешивали с 225 мкл воды. Этот раствор во второй раз разбавляли (25 мкл + 225 мкл воды). 25 мкл из окончательного раствора смешивали с 75 мкл воды и в дальнейшем добавляли к 900 мкл раствора перуксусной кислоты для анализа в кювете. Раствор инкубировали при комнатной температуре в течение 3 минут. Абсорбцию изучали при 420 нм. Концентрацию перуксусной кислоты вычисляли как: A420 × 0,242=[Перуксусная кислота] мМ.

Для первой серии измерений P. aeruginosa PA01 схема испытаний была следующей:

ОбработкаКристаллический фиолетовый (биопленка)Определение количества бактерий посевом (логарифмическое уменьшение) Общее количество пластинок
PBS контроль3 пластинки 3 пластинки6
Фермент пергидролаза с последующим удалением смеси фермента 3 пластинки3 пластинки 6
Удаление ферментов с последующим удалением фермента пергидролазы 3 пластинки3 пластинки 6
Фермент пергидролаза отдельно 3 пластинки3 пластинки 6
способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Общее число 24

Последующие тесты включали обработку смесью ферментов для удаления отдельно согласно следующей схеме испытания:

ОбработкаКристаллический фиолетовый (Биопленка)Определение количества бактерий посевом (логарифмическое уменьшение) Общее количество пластинок
PBS контроль2 пластинки 2 пластинки4
Фермент пергидролаза с последующим удалением 3 пластинки3 пластинки 6

смеси ферментаспособ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
Удаление ферментов с последующим удалением фермента пергидролазы3 пластинки 3 пластинки6
Фермент пергидролаза отдельно 2 пластинки2 пластинки 4
Смесь ферментов для удаления отдельно2 пластинки 2 пластинки4
способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Общее число 24

Анализ с помощью кристаллического фиолетового для определения эффективности удаления

Пластинки из каждой обработки помещали в 75% раствор кристаллического фиолетового в двенадцатилуночный планшет на десять минут. После окрашивания пластинки промывали три раза PBS, затем помещали в 5,0 мл 95% этанола и устанавливали на шейкер при комнатной температуре на 5 минут для элюирования кристаллического фиолетового. Элюированные растворы затем капали из пипетки в кюветы и абсорбцию изучали на спектрофотометре при 540 нм.

Определение количества бактерий посевом для определения логарифмического уменьшения

Пластины из каждой обработки помещали в стерильные конические пробирки, содержащие 10 мл стерильного PBS. Пробирки перемешивали на вортексе в течение 1 минуты, обрабатывали ультразвуком в течение 2 минут и перемешивали на вортексе в течение 30 секунд при стандартных методиках, установленных Медицинской Лабораторией Биопленок, Центра Разработки Биопленок, в Государственном Университете Штата Монтана, Боземан, Штат Монтана (MBL). Бактериальные суспензии последовательно разбавляли и высевали на чашку Петри для определения жизнеспособного числа клеток и логарифмического уменьшения в результате обработки. Для жизнеспособного вычисления клеток P. aeruginosa высевали на 100% триптический соевый агар (TSA), L. monocytogenes высевали на 1005 BHI агар и объединения питьевой воды высевали на 100% агар R2A.

Результаты

Таблица 7

Удаление биопленок Pseudomonas aeruginosa смесями ферментов и ферментом пергидролазой в CDC реакторе
Комбинация ферментовСреднее значение % сокращение биопленки (кристаллический фиолетовый)способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Станд. Откл. Среднее логарифмическое уменьшение (определение количества бактерий посевом)Станд. Откл.
Пергидролаза с последующим удалением ферментов 30,605,902,9 0,18
Удаление ферментов с последующей пергидролазой 9,266,061,7 0,50
Пергидролаза отдельно29,04 4,903,20,39
Удаляющие ферменты отдельно 25,586,36не вычисл. не вы-

числ.
способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Среднее значение трех серий опытов для первых трех обработок, перечисленных в таблице, и среднее значение двух серий опытов для четвертой обработки (удаляющие ферменты отдельно).

Таблица 8

Удаление биопленок Listeria monocytogenes смесями ферментов и ферментом пергидролазой в CDC реакторе
Комбинация ферментовСреднее значение % сокращение биопленки (кристаллический фиолетовый)способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Станд. Откл. Среднее

логарифмическое

уменьшение

(определение количества бактерий посевом)
Станд. Откл.
Пергидролаза с последующим удалением ферментов33,24 не вычисл.1,8 не вычисл.
Удаление ферментов с последующей пергидролазой25,30 не вычисл.0,9 не вычисл.
Пергидролаза отдельно 23,80не вычисл. 1,9не вычисл.
Удаляющие ферменты отдельно 23,18не вычисл. не вычисл.не вычисл.
способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Среднее значение 2 серий опытов для всех обработок, перечисленных в таблице.

Таблица 9

Удаление биопленок объединений питьевой воды смесями ферментов и ферментом пергидролазой в CDC реакторе
Комбинация ферментов% Сокращения биопленки (кристаллический фиолетовый)способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Логарифмическое уменьшение (определение количества бактерий посевом)
Пергидролаза с последующим удалением ферментов28,4 2,0
Удаление ферментов с последующей пергидролазой 28,51,0
Пергидролаза отдельно29,9 2,0
Удаляющие ферменты отдельно 21,71,4
способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Данные, основанные на одной серии опытов.

Пример 8

Удаление биопленок Pseudomonas aeruginosa смесями ферментов и ферментом пергидролазой в присутствии и без оснований

Способы

CDC реактор, оборудованный 24 полиуретановыми пластинками заполняли приблизительно 450 мл 10% TSB плюс 4 мл 24-часовой культуры Pseudomonas aeruginosa. Реактор инкубировали в течение 24 часов при периодическом режиме с непрерывным перемешиванием. При T=24 часа вводили непрерывный поток при 7 мл/мин в течение следующих 24 часов. Пластинки помещали в стерильные 12-луночные планшеты при T=48 часов (24 часа периодический режим + 24 часа непрерывный режим) для обработки фермента.

Обработка ферментов

Каждые шесть пластинок обрабатывали:

- фермент пергидролаза (разновидность S54V SEQ ED NO:1; 4 м.д.) без субстратов + смесь ферментов для удаления (1% каждый фермент)

- фермент пергидролаза (4 м.д.) без субстратов

- фермент пергидролаза (4 м.д.) с субстратами

- PBS, 7,2 (контроль)

Общее время обработки было 90 минут при температуре 45°C. По окончании обработки пластинки промывали три раза PBS.

Смеси ферментов и протоколы смешивания

Фермент пергидролаза без субстратов + смесь ферментов для удаления: PEP1, PEP2, CEL2, CAR1 и PAL1 при общей окончательной концентрации ферментов для каждого фермента 1% в 400 мМ KH2PO4 буфере при pH 7,1 плюс 4 м.д. фермента пергидролазы окончательной концентрации.

Фермент пергидролаза без субстратов: 400 мМ KH2PO 4 буфер, 4 м.д. фермента пергидролазы.

Фермент пергидролаза с субстратами: 100 мМ PGD, 100 мМ перкарбоната, 4 м.д. фермента пергидролазы, 400 мМ KH2PO4 буфера, pH 7,1. Перкарбонат взвешивали и смешивали с PGD/KH 2PO4 буфером для растворения. Добавляли пергидролазу и раствор снова перемешивали. Раствор выдерживали в течение 20 минут при комнатной температуре, затем немедленно использовали.

PBS: 8 г/л NaCl, 0,2 г/л KCl, 1,15 г/л Na2 HPO4 и 0,2 г/л KH2PO4 смешивали. Устанавливали pH 7,2 и раствор автоклавировали.

Схема испытания

Схема испытания была следующая:

ОбработкаКристаллический фиолетовый (Биопленка)Определение количества бактерий посевом (логарифмическое уменьшение) Общее количество пластинок
PBS контроль3 пластинки 3 пластинки6
Фермент пергидролаза без субстратов плюс смесь ферментов для удаления3 пластинки 3 пластинки6
Фермент пергидролаза без субстратов3 пластинки3 пластинки 6
Фермент пергидролаза с субстратами 3 пластинки3 пластинки 6
способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Общее число 24

Анализ с помощью кристаллического фиолетового для определения эффективности удаления

Пластинки после каждой обработки помещали в 75% раствор кристаллического фиолетового в двенадцатилуночный планшет на десять минут. После окрашивания пластинки промывали PBS три раза, затем помещали в 5,0 мл 95% этанола и устанавливали на шейкер при комнатной температуре на 5 минут для элюирования кристаллического фиолетового. Элюированные растворы затем капали пипеткой в кюветы и абсорбцию изучали на спектрофотометре при 540 нм.

Вычисление количества бактерий посевом для определения логарифмического уменьшения

Пластинки после каждой обработки помещали в стерильные конические пробирки, содержащие 10 мл стерильного PBS. Пробирки перемешивали на вортексе в течение 1 минуты, обрабатывали ультразвуком в течение 2 минут и перемешивали на вортексе в течение 30 секунд при стандартных методиках, установленных MBL. Бактериальные суспензии последовательно разбавляли и высевали на чашку Петри на 100% TSA для определения жизнеспособного числа клеток и логарифмического уменьшения в результате обработки.

Результаты

Таблица 10

Удаление биопленок P. aeruginosa смесями ферментов и ферментом пергидролазой в присутствии или без субстратов
способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 Абсорбция (кристалли-ческий фиолетовый) % Удаление биопленки Логарифм КОЕ/см2 (Определение количества бактерий посевом)Логарифмичес-кое уменьшение
Серия опытов 1 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
PBS контроль 0,746способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 8,0способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
Пергидролаза минус субстраты 0,63714,5 6,71,3
Пергидролаза плюс субстраты0,588 21,15,0 3,1
Пергидролаза плюс субстраты с удалением ферментов0,504 32,43,74,4
Серия опытов 2 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
PBS контроль 0,708способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 7,1способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
Пергидролаза минус субстраты 0,58217,8 5,61,6
Пергидролаза плюс субстраты0,464 34,43,8 3,4
Пергидролаза плюс субстраты с удалением ферментов0,483 31,83,93,2
Серия опытов 3 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
PBS контроль 0,783способ ферментативного удаления биопленки, композиция и набор, патент № 2495098 8,4способ ферментативного удаления биопленки, композиция и набор, патент № 2495098
Пергидролаза минус субстраты 0,49237,1 6,02,4
Пергидролаза плюс субстраты0,382 51,24,2 4,2
Пергидролаза плюс субстраты с удалением ферментов0,220 71,82,55,8

Хотя предшествующее изобретение было описано в некоторых деталях посредством иллюстрации и примеров для лучшего понимания, специалисту в данной области техники будет очевидно, что определенные изменения и модификации можно осуществить, не отступая от сущности и объема изобретения. Следовательно, описание не должно быть рассмотрено как ограничение объема притязаний настоящего изобретения.

Все публикации, патенты и доступные заявки, процитированные в настоящей заявке, включены при помощи ссылки в полном объеме для всех целей и в той же самой степени, если бы каждая индивидуальная публикация, патент или заявка на патент были определенно и индивидуально обозначены, чтобы быть включенными при помощи ссылки.

ФОРМУЛА ИЗОБРЕТЕНИЯ

1. Способ удаления биопленки с поверхности, включающий применение фермента пергидролазы и смеси ферментов для удаления к указанной биопленке в течение времени, достаточного для сокращения указанной биопленки по меньшей мере на 25%, которое составляет 45 мин,

в котором указанную смесь ферментов выбирают из протеазы, глюканазы и эстеразы или протеазы, глюканазы, эстеразы и маннаназы или протеазы, глюканазы, фосфолипазы и маннаназы или трех протеаз, глюканазы, фосфолипазы и маннаназы или трех протеаз, глюканазы и маннаназы или двух протеаз, целлюлазы, глюканаз, фосфолипазы и маннаназы или протеазы, глюканазы и маннаназы или протеазы, целлюлазы, фосфолипазы и эстеразы или двух протеаз, глюканазы, фосфолипазы и эстеразы или двух протеаз, глюканазы, фосфолипазы и маннаназы или трех протеаз, целлюлазы, фосфолипазы и глюканазы или трех протеаз, целлюлазы, фосфолипазы и маннаназы или трех протеаз, глюканазы, фосфолипазы и эстеразы или протеазы, целлюлазы, глюканазы, фосфолипазы и эстеразы или по меньшей мере двух амилаз и глюканазы, или по меньшей мере трех амилаз, или по меньшей мере двух амилаз, глюканазы и протеазы.

2. Способ по п.1, в котором фермент пергидролазу и смесь ферментов для удаления применяют к биопленке одновременно.

3. Способ по п.1, в котором фермент пергидролазу и смесь ферментов для удаления применяют к биопленке последовательно.

4. Способ по п.3, в котором фермент пергидролазу применяют до использования смеси ферментов для удаления.

5. Способ по п.1, в котором фермент пергидролаза и смесь ферментов для удаления действует синергетически для удаления биопленки с поверхности.

6. Способ по п.1, в котором биопленка содержит Pseudomonas aeruginosa, Listeria monocytogenes или Staphylococcus aureus.

7. Способ по п.1, в котором смесь ферментов для удаления состоит из трех протеаз, глюканазы, фосфолипазы и маннаназы.

8. Способ по п.1, в котором смесь ферментов для удаления состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC 265 и LYSOMAX.

9. Способ по п.1, в котором фермент пергидролаза содержит аминокислотную последовательность, описанную в SEQ ID NO:1.

10. Композиция для удаления биопленки с поверхности, содержащая фермент пергидролазу и смесь ферментов для удаления,

в котором указанная смесь ферментов для удаления выбрана из протеазы, глюканазы и эстеразы или протеазы, глюканазы, эстеразы и маннаназы или протеазы, глюканазы, фосфолипазы и маннаназы или трех протеаз, глюканазы, фосфолипазы и маннаназы или трех протеаз, глюканазы и маннаназы; двух протеаз, целлюлазы, глюканаз, фосфолипазы и маннаназы или протеазы, глюканазы и маннаназы или протеазы, целлюлазы, фосфолипазы и эстеразы или двух протеаз, глюканазы, фосфолипазы и эстеразы или двух протеаз, глюканазы, фосфолипазы и маннаназы или трех протеаз, целлюлазы, фосфолипазы и глюканазы или трех протеаз, целлюлазы, фосфолипазы и маннаназы или трех протеаз, глюканазы, фосфолипазы и эстеразы или протеазы, целлюлазы, глюканазы, фосфолипазы и эстеразы или по меньшей мере двух амилаз и глюканазы или по меньшей мере трех амилаз или по меньшей мере двух амилаз, глюканазы и протеазы.

11. Композиция по п.10, в которой смесь ферментов для удаления состоит из трех протеаз, глюканазы, фосфолипазы и маннаназы.

12. Композиция по п.10, в которой смесь ферментов для удаления состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC 265 и LYSOMAX.

13. Композиция по п.10, в которой фермент пергидролаза содержит аминокислотную последовательность, описанную в SEQ ID NO:1.

14. Набор для удаления биопленки с поверхности, указанный набор, содержащий фермент пергидролазу и смесь ферментов для удаления,

в котором указанная смесь ферментов выбрана из группы, состоящей из протеазы, глюканазы и эстеразы или протеазы, глюканазы, эстеразы и маннаназы или протеазы, глюканазы, фосфолипазы и маннаназы или трех протеаз, глюканазы, фосфолипазы и маннаназы или трех протеаз, глюканазы и маннаназы или двух протеаз, целлюлазы, глюканаз, фосфолипазы и маннаназы или протеазы, глюканазы и маннаназы или протеазы, целлюлазы, фосфолипазы и эстеразы или двух протеаз, глюканазы, фосфолипазы и эстеразы или двух протеаз, глюканазы, фосфолипазы и маннаназы или трех протеаз, целлюлазы, фосфолипазы и глюканазы или трех протеаз, целлюлазы, фосфолипазы и маннаназы или трех протеаз, глюканазы, фосфолипазы и эстеразы или протеазы, целлюлазы, глюканазы, фосфолипазы и эстеразы или по меньшей мере двух амилаз и глюканазы или по меньшей мере трех амилаз или по меньшей мере двух амилаз, глюканазы и протеазы.

15. Набор по п.14, в котором фермент пергидролаза и смесь ферментов для удаления находятся в отдельных емкостях.

16. Набор по п.14, в котором фермент пергидролаза и смесь ферментов для удаления находятся в одной и той же емкости.

17. Набор по п.14, в котором смесь ферментов для удаления состоит из трех протеаз, глюканазы, фосфолипазы и маннаназы.

18. Набор по п.14, в котором смесь ферментов для удаления состоит из PROPERASE, PURAFECT, FNA, LAMINEX BG, GC 265 и LYSOMAX.

19. Набор по п.14, в котором фермент пергидролаза содержит аминокислотную последовательность, описанную в SEQ ID NO:1.


Скачать патент РФ Официальная публикация
патента РФ № 2495098

patent-2495098.pdf
Патентный поиск по классам МПК-8:

Класс C11D3/386 препараты, содержащие ферменты

Класс C12N9/00 Ферменты, например лигазы (6); проферменты; композиции их; способы получения, активирования, ингибирования, разделения или очистки ферментов

Патенты РФ в классе C12N9/00:
нуклеиноваяя кислота, обладающая активностью гена фосфатазы фосфатидной кислоты (варианты), белок, рекомбинантный вектор, трансформант и способ получения композиции жирной кислоты -  патент 2528875 (20.09.2014)
биокатализатор для переэтерификации жиров и способ его получения -  патент 2528778 (20.09.2014)
штамм бактерий serratia species, являющийся продуцентом внеклеточной рибонуклеазы и дезоксирибонуклеазы, обладающих противовирусной активностью -  патент 2528064 (10.09.2014)
ингибитор андийского вируса крапчатости картофеля -  патент 2527899 (10.09.2014)
способ стимуляции выработки гранулоцитарного колониестимулирующего фактора клетками костного мозга in vitro -  патент 2527888 (10.09.2014)
варианты альфа-амилазы ts-23 с измененными свойствами -  патент 2526516 (20.08.2014)
способы, относящиеся к модифицированным гликанам -  патент 2526250 (20.08.2014)
моющая композиция, содержащая вариант ксилоглюканазы семейства 44 -  патент 2525669 (20.08.2014)
наноразмерный ферментный биокатализатор для детоксификации фосфорорганических соединений in vivo -  патент 2525658 (20.08.2014)
конструкции и способы для продуцирования и секреции ферментов, расщепляющих клеточную стенку -  патент 2525194 (10.08.2014)

Наверх